| PDBID: | 9obb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania brasiliensis in complex with 5-[(E)-3-(p-methoxyphenyl)-2-propenylidene]-2,4,6(1H,3H,5H)-pyrimidinetrione | | Authors: | Vaidergorn, M.M., Nonato, M.C., Froes, T.Q., Augusto, B.S. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 peptide GLAPPQHLIRV | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 mutant peptide GLAPPQHLFRV | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9obh | | Status: | HPUB -- hold until publication | | Title: | Co-Structure of SARS-CoV-2 with Compound 34 | | Authors: | Knapp, M.S., Ornelas, E. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9qz9 | | Status: | HPUB -- hold until publication | | Title: | mycobacterial cytochrome bc1:aa3 with inhibitor | | Authors: | Lamers, M.H., Verma, A.K., Noteborn, W.E.M. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9uld | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ambient temperature crystal structure of Nmar_1308 protein at 3.40 angstrom resolution | | Authors: | Destan, E., DeMirci, H. | | Deposition date: | 2025-04-19 |
|
| PDBID: | 9ul8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryogenic temperature crystal structure of Nmar_1308 protein at 2.46 angstrom resolution | | Authors: | Destan, E., DeMirci, H. | | Deposition date: | 2025-04-19 |
|
| PDBID: | 9ul9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryogenic temperature crystal structure of Nmar_1308 protein at 2.71 angstrom resolution | | Authors: | Destan, E., DeMirci, H. | | Deposition date: | 2025-04-19 |
|
| PDBID: | 9ulb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryogenic temperature crystal structure of Nmar_1308 protein at 3.29 angstrom resolution | | Authors: | Destan, E., DeMirci, H. | | Deposition date: | 2025-04-19 |
|
| PDBID: | 9ulc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ambient temperature crystal structure of Nmar_1308 protein at 3.33 angstrom resolution | | Authors: | Destan, E., DeMirci, H. | | Deposition date: | 2025-04-19 |
|
| PDBID: | 9o9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an alpha/beta-hydrolase from Actinoplanes sp. DH11 | | Authors: | Norton-Baker, B., Storment, O., Mathews, I.I., Gauthier, N.P., McGeehan, J.E., Beckham, G.T. | | Deposition date: | 2025-04-18 |
|
| PDBID: | 9o9i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mouse Vps29 bound to DENND4C peptide (re-refinement) | | Authors: | Chen, K.-E., Collins, B. | | Deposition date: | 2025-04-18 |
|
| PDBID: | 9qy5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of non-specific endoxylanase from Acetivibrio clariflavus (AcXyn30B), that belongs to subfamily GH30_12. | | Authors: | Karampa, P., Dimarogona, M., Pentari, C., Topakas, E. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9qy9 | | Status: | HPUB -- hold until publication | | Title: | Listeria monocytogenes GT108 family enzyme, native | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9o8w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 mutant, Y435F, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qy4 | | Status: | HPUB -- hold until publication | | Title: | GT108 family enzyme from Chlamydia abortus in complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qwv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma cruzi enoyl-CoA hydratase | | Authors: | Brannigan, J.A., Dodson, E.J. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
| PDBID: | 9qx3 | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-clamp in complex with designed circular peptide | | Authors: | Simonsen, S., Zhao, J., Soegaard, K., Olsen, J.G., Otterlei, M., Rogers, J.M., Kragelund, B.B. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
HHMKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL
>Entity 2
(DPN)VFVNLWYEGFS(CCS)(NH2)
|
|
| PDBID: | 9qxm | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with DMJ | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwt | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome RPS15 (uS19) P131S rotated-2 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qx4 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme purified in HEPES, with Bis-Tris propane and phosphate in the active site | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o6n | | Status: | HPUB -- hold until publication | | Title: | Structure of Siglec-10 | | Authors: | Medina, E., Ming, Q., Tran, T.H., Luca, V.C. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o6o | | Status: | HPUB -- hold until publication | | Title: | Structure of SigLec-10 in complex with 2,6-Sialyllactose | | Authors: | Medina, E., Ming, Q., Tran, T.H., Luca, V.C. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o75 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 I253M at pH 6.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o70 | | Status: | HPUB -- hold until publication | | Title: | Motif1-Motif2, two domain left-handed parallel G-quadruplex | | Authors: | Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2025-04-14 |
|
