Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8yrd
Status:HPUB -- hold until publication
Title:Cryo-EM structure of hydroxylase in soluble methane monooxygenase from Methylosinus sporium 5
Authors:Hwang, Y., Ryu, B., Pozharski, E., Lee, S.J.
Deposition date:2024-03-21
PDBID:9epu
Status:HPUB -- hold until publication
Title:Crystal structure of the human CDKL5 kinase domain with compound CAF-382
Authors:Richardson, W., Chen, X., Newman, J.A., Bakshi, S., Lakshminarayana, B., Brooke, L., Bullock, A.N.
Deposition date:2024-03-20
PDBID:9b4b
Status:HPUB -- hold until publication
Title:DNA Ligase 1 E346A/E592A double mutant with 3''ribo-8oxoG:C nick
Authors:KanalElamparithi, B., Caglayan, M.
Deposition date:2024-03-20
PDBID:9b4d
Status:AUTH -- processed, waiting for author review and approval
Title:DNA Ligase 1 E346A/E592A double mutant with 3''deoxyribo-8oxoG:C nick
Authors:KanalElamparithi, B., Caglayan, M.
Deposition date:2024-03-20
PDBID:9b4c
Status:HPUB -- hold until publication
Title:DNA Ligase 1 E346A/E592A double mutant with 3''deoxyribo-8oxoG:A nick
Authors:KanalElamparithi, B., Caglayan, M.
Deposition date:2024-03-20
PDBID:9b4a
Status:HPUB -- hold until publication
Title:DNA Ligase 1 E346A/E592A double mutant with 3''ribo-8oxoG:A nick
Authors:KanalElamparithi, B., Caglayan, M.
Deposition date:2024-03-20
PDBID:9ep8
Status:HPUB -- hold until publication
Title:Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor
Authors:Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F.
Deposition date:2024-03-18
Sequence:

>Entity 1


GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
PDBID:9b3c
Status:HPUB -- hold until publication
Title:type 2 KD-mxyl filament of miniature tau macrocycle derived from 4R tauopathic fold
Authors:Xu, X., Angera, J.I., Rajewski, H.B., Jiang, W., Del Valle, R.J.
Deposition date:2024-03-18
PDBID:8ypn
Status:HPUB -- hold until publication
Title:Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., liu, Z.
Deposition date:2024-03-17
PDBID:8ypo
Status:HPUB -- hold until publication
Title:Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z.
Deposition date:2024-03-17
PDBID:8ypl
Status:HPUB -- hold until publication
Title:Structure of dimeric phosphomimetic mutant of Tribolium castaneum (Tc) PINK1
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z.
Deposition date:2024-03-17
PDBID:8ypm
Status:HPUB -- hold until publication
Title:Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z.
Deposition date:2024-03-17
PDBID:8ypp
Status:HPUB -- hold until publication
Title:Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z.
Deposition date:2024-03-17
PDBID:8ypq
Status:HPUB -- hold until publication
Title:Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant
Authors:Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z.
Deposition date:2024-03-17
PDBID:8ypa
Status:HPUB -- hold until publication
Title:Human mitochondrial ClpP in complex with TR89
Authors:Li, Q.-N., Sun, H.-Y., Xiao, Y.-B.
Deposition date:2024-03-16
PDBID:9eoo
Status:HPUB -- hold until publication
Title:260A Vipp1 dL10Ala helical tubes in the presence of EPL
Authors:Junglas, B., Sachse, C.
Deposition date:2024-03-15
PDBID:9eou
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of the b1b2 domains from Human Neuropilin-1 in complex with a peptide.
Authors:Caing-Carlsson, R., Duelli, A., Walse, B.
Deposition date:2024-03-15
PDBID:9eon
Status:AUTH -- processed, waiting for author review and approval
Title:270A Vipp1 dL10Ala helical tubes in the presence of EPL
Authors:Junglas, B., Sachse, C.
Deposition date:2024-03-15
PDBID:9eop
Status:HPUB -- hold until publication
Title:270A Vipp1 dL10Ala helical tubes in the presence of EPL
Authors:Junglas, B., Sachse, C.
Deposition date:2024-03-15
PDBID:9eom
Status:HPUB -- hold until publication
Title:250A Vipp1 dL10Ala helical tubes in the presence of EPL
Authors:Junglas, B., Sachse, C.
Deposition date:2024-03-15
PDBID:9b2m
Status:HPUB -- hold until publication
Title:Hemagglutinin H1 New Caledonia 1999 in complex with monoclonal antibody Fab 43_S0008
Authors:Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B., Ataca, S., Kanekiyo, M.
Deposition date:2024-03-15
PDBID:9eo3
Status:HPUB -- hold until publication
Title:Crystal structure of tyrosinase (WT) from Bacillus megaterium soaked in Cu(II)
Authors:Englund, A.N.B., Rohr, A.K., Dalleywater, E.L.
Deposition date:2024-03-14
PDBID:9b24
Status:AUTH -- processed, waiting for author review and approval
Title:WT strain gidB mutant mycobacterial ribosome
Authors:Young, I.D., Chen, Y., Javid, B., Fraser, J.S.
Deposition date:2024-03-14
PDBID:9b1x
Status:AUTH -- processed, waiting for author review and approval
Title:HWS19 strain gidB mutant mycobacterial ribosome
Authors:Chen, Y., Young, I.D., Fraser, J.S., Javid, B.
Deposition date:2024-03-14
PDBID:9b1w
Status:AUTH -- processed, waiting for author review and approval
Title:HWS19 strain WT mycobacterial ribosome
Authors:Young, I.D., Chen, Y., Javid, B., Fraser, J.S.
Deposition date:2024-03-14

221051

数据于2024-06-12公开中

PDB statisticsPDBj update infoContact PDBjnumon