| PDBID: | 9ycd | | Status: | AUCO -- author corrections pending review | | Title: | Leucine Rich Repeat Kinase 2 R1441C mutant (active) | | Authors: | Villagran Suarez, A., Bodrug, T., Leschziner, A. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9yce | | Status: | HPUB -- hold until publication | | Title: | Active site of MtgB, a glycine betaine methyltransferase from the MttB superfamily | | Authors: | Picking, J., Li, Y., Ticak, T., Ferguson, D.J., Hao, B., Krzycki, J.A. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9spz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Molybdenum-containing nitrogenase from Methanocaldococcus infernus refined to 1.37 A resolution - crystalline form A | | Authors: | Maslac, N., Torer, M.R., Bolte, P., Wagner, T. | | Deposition date: | 2025-09-18 | | Sequence: | >Entity 1
MPFVLLDCDKPIPERMKHTYIYDPEEEIIPACNIKTIPGDMTERGCSFAGARGVVGGPVKDVIHMVHGPIGCAFYTWGTRRNLSDFELHRRYCFSTDMQEADIVYGGEKKLEKACIEAAEEFPEAKGIFIYATCPTALIGDNLEAVARKVEEKIKKPVFACNSPGFAGCSQSKGHHIFNTEFYRWLRKAREKYPEKCLKEEEKTPYDIAIVGEYNMDWDLKVIKPLFEKIGCRVVAVFTGNASLDDLFKLPDVKLCVVHCQRSANYIAEMIRDGYNVPRVWVSLFGIEQTAEALRKTAEVLGIDKEKVEQVIKEEVEAIKPQLEFYKSKLEGKRCLVYVGGPRTWHWIRMFKELGVDVVVACCTFAHEDDYEKLNRNLKKAGLKGTLVIDAPNELELEEAIHKYKPDFMLTGLKERYLFRKYGVPTINSHSYEQGPYAGFRGFVNFARDIYKAVCHPIWDILKEGEKKFEEFKKKNN
>Entity 2
MGITYVEKQRAVTINPNKICQPIGAMWATLGVHRAIPFVQGSQGCCTYVRYTFNRHFREPVSIAVASFHEDAAVYGGMKNLVEGIRNLVARYDPDLISVVTTCSSETIGDDIEAFIRAARKKIAKEFGEEKAKLPIIPVHCPSYQASHVKGYDNASKAFLEYLAKKDEEKEPHKINIIPGFGVNPGDILEIKRILDMFGLKEGEDYSILFDISETLYQPLREPIKEIPYYPKGGTKVEEFVDAANAKATFALCKHAGGAGALYLQRKYKVPAYYGLPIGIKNTDDFIINIAKVTGLDIPDKLLDERGKLIDAIVDTVHYTMDKKVGIFGDPDFVIAVSRFCCEIGMKPVVVNTQTPSNTYKKAMEEIANEYNVDIEVQFSDLWDFEKSVKKIGVDLLIGHPRGGVKIAEDLGIGLVRMGFPIYDRVGYFRWPIVGYMGSLRFFDEIVNTILDTQVPWDQKQQ
|
|
| PDBID: | 9spy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure Of IgGFc-FcRn in complex with VHH 81B10 | | Authors: | Kumar, A., Bertrand, T. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wu2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cZ22-Fab in complex with left-handed dC(GC)3 DNA | | Authors: | Lee, C.C., Hsu, S.F., Ko, T.P., Wang, A.H.J. | | Deposition date: | 2025-09-17 |
|
| PDBID: | 9spj | | Status: | PROC -- to be processed | | Title: | CryoEM structure of the vacant Candida auris 80S ribosome | | Authors: | Atamas, A., Stetsenko, A., Incarnato, D., Macia Valero, A., Rogachev, A., Billerbeck, S., Guskov, A. | | Deposition date: | 2025-09-17 |
|
| PDBID: | 9spf | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN 80S RIBOSOME WITH A/P/E-SITE TRNA AND MRNA CONTAINING N1-METHYLPSEUDOURIDINE | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2025-09-17 |
|
| PDBID: | 9spi | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN 80S RIBOSOME WITH A/P/E-SITE TRNA AND MRNA CONTAINING URIDINE | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2025-09-17 |
|
| PDBID: | 9spl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | D-stereospecific hydrolase I from Bacillus thuringiensis Berliner 1915 | | Authors: | Schoepfel, M., Parthier, C., Bordusa, F., Stubbs, M.T., Simon, A.H. | | Deposition date: | 2025-09-17 | | Release date: | 2026-09-17 |
|
| PDBID: | 9wtf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of D175A mutant complex with octanoyl CoA of Rv3272 from Mycobacterium tuberculosis | | Authors: | Shakya, A.K., Verma, S., Pratap, J.V. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9wte | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of D175A mutant complex with butanoyl CoA of Rv3272 from Mycobacterium tuberculosis | | Authors: | Shakya, A.K., Verma, S., Pratap, J.V. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9wth | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of D175A mutant with Decanoyl CoA of Rv3272 from Mycobacterium tuberculosis orthorhombic form | | Authors: | Verma, S., Shakya, A.K., Pratap, J.V. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9wti | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of D175A mutant complex with Palmitoyl CoA of Rv3272 from Mycobacterium tuberculosis | | Authors: | Shakya, A.K., Verma, S., Pratap, J.V. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9wtg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of D175A mutant complex with deconoyl CoA of Rv3272 from Mycobaterium tuberculosis monoclinic form | | Authors: | Verma, S., Shakya, A.K., Pratap, J.V. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yb3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Localized reconstruction of the asymmetric unit of SINV/EEEV. | | Authors: | Bandyopadhyay, A., Klose, T., Kuhn, R.J. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yb4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV. | | Authors: | Bandyopadhyay, A., Klose, T., Kuhn, R.J. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yb2 | | Status: | HPUB -- hold until publication | | Title: | Localized reconstruction of the asymmetric unit of SINV/EEEV at 40C sample. | | Authors: | Bandyopadhyay, A., Klose, T., Kuhn, R.J. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yaz | | Status: | HPUB -- hold until publication | | Title: | Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-179 at 40C sample. | | Authors: | Bandyopadhyay, A., Klose, T., Kuhn, R.J. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yax | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Localized reconstruction of the asymmetric unit of the low pH treated back neutralized SINV/EEEV in complex with Fab fragment of the antibody EEEV-179 | | Authors: | Bandyopadhyay, A., Klose, T., Kuhn, R.J. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yb1 | | Status: | HPUB -- hold until publication | | Title: | Localized reconstruction of the asymmetric unit of SINV/EEEV at pH 5.6. | | Authors: | Bandyopadhyay, A., Klose, T., Kuhn, R.J. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yaw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Localized reconstruction of the asymmetric unit of SINV/EEEV in complex with Fab EEEV-33 at arm 4 at pH 5.6. | | Authors: | Bandyopadhyay, A., Klose, T., Kuhn, R.J. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yaj | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of SARS-CoV-2 nsp9 in complex with the AT501 inhibitor | | Authors: | Rahisuddin, R., Misra, A., Gupta, Y.K. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yao | | Status: | HPUB -- hold until publication | | Title: | Gbg crosslinked to PLCb3 - second conformation | | Authors: | Fisher, I.J., Lyon, A.M. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9yap | | Status: | HPUB -- hold until publication | | Title: | Gbg crosslinked to PLCb3 - second conformation | | Authors: | Fisher, I.J., Lyon, A.M. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9soy | | Status: | HPUB -- hold until publication | | Title: | Structure of the ligand binding domain of the ancestral reconstructed Pseudomonas chemoreceptor aPcpI in complex with salicylate | | Authors: | Gavira, J.A., Rico-Jimenez, M., Ortega, A., Roca, A., Krell, T., Zhulin, I.B., Matilla, M.A. | | Deposition date: | 2025-09-16 |
|
