PDBID: | 8znq | Status: | HOLD -- hold until a certain date | Title: | Solution structure of the complex of naphthyridine-azaquinolone and an RNA with ACG/AUA motif | Authors: | Fujiwara, A., Chen, Q., Nakatani, K., Murata, A., Kawai, G. | Deposition date: | 2024-05-27 | Release date: | 2025-05-27 |
|
PDBID: | 9fcv | Status: | PROC -- to be processed | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | Deposition date: | 2024-05-16 |
|
PDBID: | 9bez | Status: | HPUB -- hold until publication | Title: | MID domain of human Argo2 bound to RNA | Authors: | Harp, J.M., Egli, M. | Deposition date: | 2024-04-16 |
|
PDBID: | 9be8 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9be7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bds | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-12 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9exn | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | The vaccinia minimal RNA polymerase cryo EM structure at 1.9A resolution | Authors: | Grimm, C., Jungwirth, S., Fischer, U. | Deposition date: | 2024-04-08 |
|
PDBID: | 8yqt | Status: | AUTH -- processed, waiting for author review and approval | Title: | African swine fever virus RNA Polymerase-M1249L complex2 | Authors: | Feng, X.Y. | Deposition date: | 2024-03-20 |
|
PDBID: | 8yqy | Status: | AUTH -- processed, waiting for author review and approval | Title: | ASFV RNA polymerase-M1249L complex complete | Authors: | Feng, X.Y., Feng, X.Y. | Deposition date: | 2024-03-20 |
|
PDBID: | 8yqz | Status: | AUTH -- processed, waiting for author review and approval | Title: | African swine fever virus RNA Polymerase--DNA complex | Authors: | Feng, X.Y. | Deposition date: | 2024-03-20 |
|
PDBID: | 8yqu | Status: | AUTH -- processed, waiting for author review and approval | Title: | African swine fever virus RNA Polymerase-M1249L complex1 | Authors: | Feng, X.Y. | Deposition date: | 2024-03-20 |
|
PDBID: | 8yqv | Status: | AUTH -- processed, waiting for author review and approval | Title: | African swine fever virus RNA Polymerase core | Authors: | Feng, X.Y. | Deposition date: | 2024-03-20 |
|
PDBID: | 8yqw | Status: | AUTH -- processed, waiting for author review and approval | Title: | ASFV RNA polymerase-M1249L complex3 | Authors: | Feng, X.Y., Feng, X.Y. | Deposition date: | 2024-03-20 |
|
PDBID: | 8yqx | Status: | AUTH -- processed, waiting for author review and approval | Title: | ASFV RNA polymerase-M1249L complex4 | Authors: | Feng, X.Y., Feng, X.Y. | Deposition date: | 2024-03-20 |
|
PDBID: | 9epc | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | Deposition date: | 2024-03-18 |
|
PDBID: | 9b2k | Status: | AUTH -- processed, waiting for author review and approval | Title: | SpCas9 with dual-guide RNA in open conformation | Authors: | Korolev, S., Gagnon, K. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eow | Status: | HPUB -- hold until publication | Title: | The 5-terminal stem-loop RNA element of SARS-CoV-2 features highly dynamic structural elements that are sensitive to differences in cellular pH | Authors: | Wacker, A., Schwalbe, H. | Deposition date: | 2024-03-15 | Sequence: | >Entity 1 GGGUUUAUACCUUCCCAGGUAACAAACCC
|
|
PDBID: | 8yno | Status: | HPUB -- hold until publication | Title: | RNA duplex containing Formamide | Authors: | Kondo, J., Abe, H. | Deposition date: | 2024-03-11 |
|
PDBID: | 8ynp | Status: | HPUB -- hold until publication | Title: | RNA duplex containing Methylformamide | Authors: | Kondo, J., Abe, H. | Deposition date: | 2024-03-11 |
|
PDBID: | 8s6w | Status: | HPUB -- hold until publication | Title: | Small circular RNA dimer | Authors: | McRae, E.K., Kristoffersen, E.L., Holliger, P., Andersen, E.S. | Deposition date: | 2024-02-28 |
|
PDBID: | 8yha | Status: | HPUB -- hold until publication | Title: | pro-RNA-DNA complex 60-4 | Authors: | Li, Z. | Deposition date: | 2024-02-27 |
|
PDBID: | 8yh9 | Status: | HPUB -- hold until publication | Title: | pro-RNA complex | Authors: | Li, Z. | Deposition date: | 2024-02-27 |
|
PDBID: | 8yg9 | Status: | HPUB -- hold until publication | Title: | pro-RNA-DNA complex 60 | Authors: | Li, Z. | Deposition date: | 2024-02-26 |
|
PDBID: | 8yeo | Status: | HPUB -- hold until publication | Title: | pro-RNA-DNA complex 53 | Authors: | Li, Z. | Deposition date: | 2024-02-22 |
|
PDBID: | 8ydb | Status: | HPUB -- hold until publication | Title: | pro-RNA-DNA complex 51 | Authors: | Li, Z. | Deposition date: | 2024-02-19 |
|