Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9g92
Status:PROC -- to be processed
Title:Crystal structure of thioredoxin reductase from Cryptosporidium parvum in the ""in"" conformation
Authors:Gabriele, F., Palerma, M., Ardini, M., Bogard, J., Chen, X.M., Williams, D.L., Angelucci, F.
Deposition date:2024-07-24
PDBID:9g8k
Status:PROC -- to be processed
Title:Structure of K+-dependent Na+-PPase from Thermotoga maritima in complex with Ca2+ and Etidtronate
Authors:Vidilaseris, K., Liu, J., Goldman, A.
Deposition date:2024-07-23
PDBID:9g8j
Status:AUCO -- author corrections pending review
Title:Structure of K+-dependent Na+-PPase from Thermotoga maritima in complex with zoledronate
Authors:Vidilaseris, K., Liu, J., Goldman, A.
Deposition date:2024-07-23
PDBID:9fzf
Status:AUTH -- processed, waiting for author review and approval
Title:Transcriptional repressor NrdR from E. coli, ADP/dATP bound state
Authors:Bimai, O., Rozman Grinberg, I., Sjoberg, B.M., Logan, D.T.
Deposition date:2024-07-05
PDBID:9fyj
Status:AUTH -- processed, waiting for author review and approval
Title:N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand
Authors:Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T.
Deposition date:2024-07-03
PDBID:9fxk
Status:HPUB -- hold until publication
Title:Transcription repressor NrdR from E. coli, AMPPNP/ATP-bound state
Authors:Bimai, O., Logan, D.T.
Deposition date:2024-07-01
PDBID:9fvr
Status:AUTH -- processed, waiting for author review and approval
Title:Transcription repressor NrdR from E. coli, ATP/dATP-bound state, SeMet protein
Authors:Bimai, O., Sjoberg, B.M., Rozman Grinberg, I., Logan, D.T.
Deposition date:2024-06-28
PDBID:9fm8
Status:HPUB -- hold until publication
Title:Imine Reductase from Rhodococcus erythropolis
Authors:Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G.
Deposition date:2024-06-05
PDBID:9fm7
Status:HPUB -- hold until publication
Title:Imine Reductase from Rhodococcus erythropolis
Authors:Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G.
Deposition date:2024-06-05
PDBID:8zom
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of pyraclostrobin-bound Arachis hypogaea bc1 complex
Authors:Cui, G.R., Wang, Y.X., Yang, G.F.
Deposition date:2024-05-28
PDBID:8zno
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Arachis hypogaea bc1 complex
Authors:Ye, Y., Dong, J.Q., Yang, G.F.
Deposition date:2024-05-27
PDBID:9f7i
Status:HPUB -- hold until publication
Title:Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7
Authors:Brangulis, K., Surth, V., Marcinkiewicz, A.L., Akopjana, I., Kazaks, A., Bogans, J., Huber, A., Lin, Y.-P., Kraiczy, P.
Deposition date:2024-05-03
PDBID:9f7k
Status:HPUB -- hold until publication
Title:Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione
Authors:Didierjean, C., Schwartz, M., Neiers, F.
Deposition date:2024-05-03
Sequence:

>Entity 1


MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
PDBID:9f09
Status:HPUB -- hold until publication
Title:Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Complex with 2-deoxyribose, 7-Bromo-1H-imidazo[4,5-b]pyridine and 2''-deoxycytidine
Authors:Ascham, A., Salihovic, A., Burley, G., Grogan, G.
Deposition date:2024-04-15
PDBID:9f08
Status:HPUB -- hold until publication
Title:Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Covalent complex with 2-deoxyribose.
Authors:Ascham, A., Salihovic, A., Burley, G., Grogan, G.
Deposition date:2024-04-15
PDBID:9ezk
Status:HPUB -- hold until publication
Title:Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii (apo).
Authors:Ascham, A., Salihovic, A., Burley, G., Grogan, G.
Deposition date:2024-04-12
PDBID:9ba8
Status:AUTH -- processed, waiting for author review and approval
Title:O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease
Authors:Hendle, J.
Deposition date:2024-04-03
PDBID:9ba9
Status:AUTH -- processed, waiting for author review and approval
Title:O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease
Authors:Hendle, J.
Deposition date:2024-04-03
PDBID:9euz
Status:HPUB -- hold until publication
Title:Glycoside hydrolase family 114 enzyme from Thermotoga maritima
Authors:Roth, C.
Deposition date:2024-03-28
PDBID:8yue
Status:HPUB -- hold until publication
Title:Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster
Authors:Wei, Y., Jobichen, C., Imasaki, T., Nitta, R., Wang, M.Y., Sivaraman, J., Endow, S.A.
Deposition date:2024-03-27
PDBID:8y9q
Status:HPUB -- hold until publication
Title:b-glucosidase from Thermotoga profunda Tp-BGL
Authors:Guo, Y., Chen, A.
Deposition date:2024-02-07
PDBID:8rxm
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Galectin-3 in complex with thiogalactoside derivative
Authors:Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U.
Deposition date:2024-02-07
PDBID:8y1x
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the aspartate:alanine antiporter AspT WT
Authors:Nanatani, K., Kanno, R., Kawabata, T., Watanabe, S., Hidaka, M., Yamanaka, T., Toda, K., Fujiki, T., Kunii, K., Miyamoto, A., Chiba, F., Ogasawara, S., Murata, T., Humbel, B.M., Inaba, K., Mitsuoka, K., Guan, L., Abe, K., Yamamoto, M., Koshiba, S.
Deposition date:2024-01-25
PDBID:8xxk
Status:HPUB -- hold until publication
Title:Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction intermediate derived from the crystal soaked into the solution at pH 4.0 under 298 K for 3 weeks
Authors:Unno, M., Koga, M., Miniwa, N., Komuro, S., Tanaka, Y.
Deposition date:2024-01-18
PDBID:8xwc
Status:HPUB -- hold until publication
Title:Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the substrate 8-oxoguanine DNA at pH 8.0 under 277 K
Authors:Unno, M., Koga, M., Minowa, N., Komuro, S., Tanaka, Y.
Deposition date:2024-01-16

 

12>

223166

건을2024-07-31부터공개중

PDB statisticsPDBj update infoContact PDBjnumon