PDBID: | 9g92 | Status: | PROC -- to be processed | Title: | Crystal structure of thioredoxin reductase from Cryptosporidium parvum in the ""in"" conformation | Authors: | Gabriele, F., Palerma, M., Ardini, M., Bogard, J., Chen, X.M., Williams, D.L., Angelucci, F. | Deposition date: | 2024-07-24 |
|
PDBID: | 9g8k | Status: | PROC -- to be processed | Title: | Structure of K+-dependent Na+-PPase from Thermotoga maritima in complex with Ca2+ and Etidtronate | Authors: | Vidilaseris, K., Liu, J., Goldman, A. | Deposition date: | 2024-07-23 |
|
PDBID: | 9g8j | Status: | AUCO -- author corrections pending review | Title: | Structure of K+-dependent Na+-PPase from Thermotoga maritima in complex with zoledronate | Authors: | Vidilaseris, K., Liu, J., Goldman, A. | Deposition date: | 2024-07-23 |
|
PDBID: | 9fzf | Status: | AUTH -- processed, waiting for author review and approval | Title: | Transcriptional repressor NrdR from E. coli, ADP/dATP bound state | Authors: | Bimai, O., Rozman Grinberg, I., Sjoberg, B.M., Logan, D.T. | Deposition date: | 2024-07-05 |
|
PDBID: | 9fyj | Status: | AUTH -- processed, waiting for author review and approval | Title: | N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand | Authors: | Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T. | Deposition date: | 2024-07-03 |
|
PDBID: | 9fxk | Status: | HPUB -- hold until publication | Title: | Transcription repressor NrdR from E. coli, AMPPNP/ATP-bound state | Authors: | Bimai, O., Logan, D.T. | Deposition date: | 2024-07-01 |
|
PDBID: | 9fvr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Transcription repressor NrdR from E. coli, ATP/dATP-bound state, SeMet protein | Authors: | Bimai, O., Sjoberg, B.M., Rozman Grinberg, I., Logan, D.T. | Deposition date: | 2024-06-28 |
|
PDBID: | 9fm8 | Status: | HPUB -- hold until publication | Title: | Imine Reductase from Rhodococcus erythropolis | Authors: | Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G. | Deposition date: | 2024-06-05 |
|
PDBID: | 9fm7 | Status: | HPUB -- hold until publication | Title: | Imine Reductase from Rhodococcus erythropolis | Authors: | Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G. | Deposition date: | 2024-06-05 |
|
PDBID: | 8zom | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of pyraclostrobin-bound Arachis hypogaea bc1 complex | Authors: | Cui, G.R., Wang, Y.X., Yang, G.F. | Deposition date: | 2024-05-28 |
|
PDBID: | 8zno | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Arachis hypogaea bc1 complex | Authors: | Ye, Y., Dong, J.Q., Yang, G.F. | Deposition date: | 2024-05-27 |
|
PDBID: | 9f7i | Status: | HPUB -- hold until publication | Title: | Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7 | Authors: | Brangulis, K., Surth, V., Marcinkiewicz, A.L., Akopjana, I., Kazaks, A., Bogans, J., Huber, A., Lin, Y.-P., Kraiczy, P. | Deposition date: | 2024-05-03 |
|
PDBID: | 9f7k | Status: | HPUB -- hold until publication | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | Deposition date: | 2024-05-03 | Sequence: | >Entity 1 MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
PDBID: | 9f09 | Status: | HPUB -- hold until publication | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Complex with 2-deoxyribose, 7-Bromo-1H-imidazo[4,5-b]pyridine and 2''-deoxycytidine | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | Deposition date: | 2024-04-15 |
|
PDBID: | 9f08 | Status: | HPUB -- hold until publication | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Covalent complex with 2-deoxyribose. | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | Deposition date: | 2024-04-15 |
|
PDBID: | 9ezk | Status: | HPUB -- hold until publication | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii (apo). | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | Deposition date: | 2024-04-12 |
|
PDBID: | 9ba8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | Authors: | Hendle, J. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | Authors: | Hendle, J. | Deposition date: | 2024-04-03 |
|
PDBID: | 9euz | Status: | HPUB -- hold until publication | Title: | Glycoside hydrolase family 114 enzyme from Thermotoga maritima | Authors: | Roth, C. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yue | Status: | HPUB -- hold until publication | Title: | Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster | Authors: | Wei, Y., Jobichen, C., Imasaki, T., Nitta, R., Wang, M.Y., Sivaraman, J., Endow, S.A. | Deposition date: | 2024-03-27 |
|
PDBID: | 8y9q | Status: | HPUB -- hold until publication | Title: | b-glucosidase from Thermotoga profunda Tp-BGL | Authors: | Guo, Y., Chen, A. | Deposition date: | 2024-02-07 |
|
PDBID: | 8rxm | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Galectin-3 in complex with thiogalactoside derivative | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | Deposition date: | 2024-02-07 |
|
PDBID: | 8y1x | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the aspartate:alanine antiporter AspT WT | Authors: | Nanatani, K., Kanno, R., Kawabata, T., Watanabe, S., Hidaka, M., Yamanaka, T., Toda, K., Fujiki, T., Kunii, K., Miyamoto, A., Chiba, F., Ogasawara, S., Murata, T., Humbel, B.M., Inaba, K., Mitsuoka, K., Guan, L., Abe, K., Yamamoto, M., Koshiba, S. | Deposition date: | 2024-01-25 |
|
PDBID: | 8xxk | Status: | HPUB -- hold until publication | Title: | Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction intermediate derived from the crystal soaked into the solution at pH 4.0 under 298 K for 3 weeks | Authors: | Unno, M., Koga, M., Miniwa, N., Komuro, S., Tanaka, Y. | Deposition date: | 2024-01-18 |
|
PDBID: | 8xwc | Status: | HPUB -- hold until publication | Title: | Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the substrate 8-oxoguanine DNA at pH 8.0 under 277 K | Authors: | Unno, M., Koga, M., Minowa, N., Komuro, S., Tanaka, Y. | Deposition date: | 2024-01-16 |
|