PDBID: | 9j8z | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of human HCAR1-Gi complex without ligand (apo state) | Authors: | Xin, P., Fang, Y. | Deposition date: | 2024-08-21 | Release date: | 2025-08-21 |
|
PDBID: | 9j8k | Status: | PROC -- to be processed | Title: | Crystal structure of the GluA2 ligand binding core (S1S2J) in complex with fluorophore-ligand conjugate | Authors: | Fujiwara, T., Adriel, H., Soga, K., Kiyonaka, S., Nango, E. | Deposition date: | 2024-08-21 |
|
PDBID: | 9j8f | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structural insights into BirA from Haemophilus influenzae, a bifunctional protein as a biotin protein ligase and a transcriptional repressor | Authors: | Lee, J.Y., Jeong, K.H., Son, S.B., Ko, J.H. | Deposition date: | 2024-08-21 |
|
PDBID: | 9j8e | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structural insights into BirA from Haemophilus influenzae, a bifunctional protein as a biotin protein ligase and a transcriptional repressor | Authors: | Lee, J.Y., Jeong, K.H., Son, S.B., Ko, J.H. | Deposition date: | 2024-08-21 |
|
PDBID: | 9d7r | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Fva1 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | Deposition date: | 2024-08-17 |
|
PDBID: | 9d7s | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.85A resolution | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | Deposition date: | 2024-08-17 |
|
PDBID: | 9d7t | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api137 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | Deposition date: | 2024-08-17 |
|
PDBID: | 9d4z | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of PAR1 with endogenous tethered ligand | Authors: | Lyu, X., Lyu, Z., McGrath, A.P., Kang, Y. | Deposition date: | 2024-08-13 |
|
PDBID: | 9d57 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | iGABASnFR2 fluorescent GABA sensor in complex with GABA | Authors: | Zhang, Y., Looger, L.L. | Deposition date: | 2024-08-13 |
|
PDBID: | 9j56 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Functional Investigation of the SAM-Dependent Methyltransferases Rdmb in Anthracycline Biosynthesis | Authors: | Yang, Q.Y., Sang, M.L., Zhang, W. | Deposition date: | 2024-08-11 |
|
PDBID: | 9gfe | Status: | AUTH -- processed, waiting for author review and approval | Title: | hRAR LBD protein in complex with AM580 agonist ligand and a stapled peptide | Authors: | Perdriau, C., Luton, A., Zimmeter, K., Neuville, M., Saragaglia, C., Peluso-lltis, C., Kauffmann, B., Collie, G., Rochel, N., Guichard, G., Pasco, M. | Deposition date: | 2024-08-09 |
|
PDBID: | 9gf9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | S-Protease complexed with stapled peptide-like ligand | Authors: | Perdriau, C., Luton, A., Zimmeter, K., Neuville, M., Saragaglia, C., Peluso-lltis, C., Osz, J., Kauffmann, B., Collie, G., Rochel, N., Guichard, G., Pasco, M. | Deposition date: | 2024-08-08 |
|
PDBID: | 9gfc | Status: | AUTH -- processed, waiting for author review and approval | Title: | HDM2 complexed with stapled peptide-like ligand | Authors: | Perdriau, C., Luton, A., Zimmeter, K., Neuville, M., Saragaglia, C., Peluso-lltis, C., Osz, J., Kauffmann, B., Collie, G., Rochel, N., Guichard, G., Pasco, M. | Deposition date: | 2024-08-08 |
|
PDBID: | 9d02 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Co-crystal structure of circularly permuted human taspase-1 bound to ligand SMDC1014883 (2R)-4-(ethenesulfonyl)-1-{[3-fluoro-4-(trifluoromethoxy)phenyl]methyl}-2-[(prop-2-yn-1-yloxy)methyl]piperazine | Authors: | Delker, S.L., Edwards, T.E., Abendroth, J. | Deposition date: | 2024-08-06 |
|
PDBID: | 9d03 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Co-crystal structure of circularly permuted human taspase-1 bound to ligand SMDC1014689 1-(ethenesulfonyl)-4-{[3-fluoro-4-(trifluoromethoxy)phenyl]methyl}piperazine | Authors: | Delker, S.L., Edwards, T.E., Abendroth, J. | Deposition date: | 2024-08-06 |
|
PDBID: | 9d04 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CO-CRYSTAL STRUCTURE OF CIRCULARLY PERMUTED HUMAN TASPASE-1 BOUND TO LIGAND SMDC994967 1-(ETHENESULFONYL)-4-{[4- (TRIFLUOROMETHOXY)PHENYL]METHYL}PIPERAZINE | Authors: | Delker, S.L., Edwards, T.E., Abendroth, J. | Deposition date: | 2024-08-06 |
|
PDBID: | 9d0a | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | CryoEM structure of PAR2 with endogenous tethered ligand. | Authors: | Lyu, Z., Lyu, X., McGrath, A.P., Kang, Y. | Deposition date: | 2024-08-06 |
|
PDBID: | 9j1a | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of ConA without ligand | Authors: | Li, L., Chen, G. | Deposition date: | 2024-08-04 |
|
PDBID: | 9cy8 | Status: | HPUB -- hold until publication | Title: | Constrained b-hairpins targeting the EphA4 ligand binding domain | Authors: | Muzzarelli, K.M., Assar, Z., Prentis, A.M., Baggio, C., Pellecchia, M. | Deposition date: | 2024-08-01 |
|
PDBID: | 9it0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Ligand bound acetyltransferase | Authors: | Park, J.B. | Deposition date: | 2024-07-19 |
|
PDBID: | 9isx | Status: | HOLD -- hold until a certain date | Title: | A membrane protein with ligands | Authors: | Shi, J.H., Li, A., Ma, D. | Deposition date: | 2024-07-18 | Release date: | 2025-07-18 |
|
PDBID: | 9ir5 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of apo-form UDP-N-acetylmuramic Acid L-alanine ligase (MurC) from Roseburia faecis | Authors: | Wang, Y.X., Du, Y.H. | Deposition date: | 2024-07-14 | Release date: | 2025-07-14 | Sequence: | >Entity 1 SMYKLKFNDPIHIHFIGIGGISMSGLAEILLEKGFTISGSDAKESDLTRMLASKGAQIFYRQSAENIIPGIDLVVYTAAIHPDNPEFAEARSQGLPMLSRAELLGQIMDNYNNSVAVAGTHGKTTTTSMISEILLAAKSDPTITVGGILPSIGGNLRVGHSGIFVSEACEYTNSFLNFRPKYSIILNVEAEHLDFFKDINDIRRSFRKFAGNTLADGATIINGEIADHQELTDGLPQQIITYGFDDSCEYYADNLTYDDKACPSFTAMHNKEAICEIKLAVPGRHNAGNAMAAIALACTMGISTDAIIRGLDAFHGANRRFQYKGTVDGVTIIDDYAHHPTEIRATLTAAQKYPHKRLVLVFQPHTYSRTKAFLDDFAEVLSMADVIVLADIFAAREQNTFGVSSKDILERLTAKGKDAHYFPSFEEIEKFLLKNCMNGDLLITMGAGNVVEIGESLLGK
|
|
PDBID: | 9ckq | Status: | HPUB -- hold until publication | Title: | Human G protein-coupled receptor kinase 5-D311N ligand-free form | Authors: | Chen, Y., Tesmer, J.J.G. | Deposition date: | 2024-07-09 |
|
PDBID: | 9fzx | Status: | HPUB -- hold until publication | Title: | Rhizobium phage ligase | Authors: | Rothweiler, U., Williamson, A. | Deposition date: | 2024-07-06 |
|
PDBID: | 9fyj | Status: | HPUB -- hold until publication | Title: | N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand | Authors: | Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T. | Deposition date: | 2024-07-03 | Sequence: | >Entity 1 SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSD
|
|