| PDBID: | 9djo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9djq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9diz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9djr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9dix | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9diy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9djv | | Status: | HPUB -- hold until publication | | Title: | apo aplysia Slo1 R199Q | | Authors: | Gustavo, G.F., Shen, R., Latorre, R., Perozo, E. | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9dju | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9dj7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9djs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9dj8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9djt | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-09-06 |
|
| PDBID: | 9gof | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 | | Sequence: | >Entity 1
MQSEQWRSLSNVVWGKDLPAFTYAFSKTPLVLYDGGTTKQVGTYNFPVSKGMAGVYMSLEPGAIRELHWHANAAEWAYVMEGRTRITLTSPEGKVEIADVDKGGLWYFPRGWGHSIEGIGPDTAKFLLVFNDGTFSEGATFSVTDWLSHTPIAWVEENLGWTAAQVAQLPKKQVYISSYGPASGPLASATPQGQTAKIEVPHTHNLLGQQPLVSLGGNELRLASAKEFPGSFNMTGALIHLEPGAMRQLHWHPNADEWQYVLDGEMDLTVFASEGKASVSRLQQGDVGYVPKGYGHAIRNSSQKPLDIVVVFNDGDYQSIDLSTWLASNPSSVLGNTFQISPELTKKLPVQDTIFSLPTQP
|
|
| PDBID: | 9goi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gon | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DPP9 in complex with sulphostin | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DPP9 Ser730Ala in complex with sulphostin. | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9go8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9god | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DPP9 in complex with N-phosphono-(S)-3-aminopiperidine-2-one-based inhibitor | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gog | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with furan-2-carboxylic acid (3-ethoxy-2-hydroxybenzylidene)hydrazide | | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gol | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of limonene epoxide hydrolase LEH 19 | | Authors: | Levy, C.W. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gok | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with (E)-N''-(1-(2-hydroxy-5-methoxyphenyl)ethylidene)furan-2-carbohydrazide) | | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gom | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of limonene epoxide hydrolase LEH 31 | | Authors: | Levy, C.W. | | Deposition date: | 2024-09-05 |
|
