| PDBID: | 9g3v | | Status: | HPUB -- hold until publication | | Title: | Structure of the human nuclear cap-binding-complex (CBC) | | Authors: | Martin, K., Hoh, F., Trapani, S., Tazi, J., Bron, P. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9cgh | | Status: | HPUB -- hold until publication | | Title: | Photoactive yellow protein crystallized in situ on cyclic olefin copolymer microfluidic chip through counter diffusion | | Authors: | Liu, Z., Gu, K.K., Shelby, M.L., Roy, D., Muniyappan, S., Schmidt, M., Narayanasamy, S.R., Coleman, M.A., Frank, M., Kuhl, T.L. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9c8c | | Status: | HPUB -- hold until publication | | Title: | Structure of proline utilization A with the FAD covalently-modified by propanal resulting from inactivation with N-allylglycine | | Authors: | Tanner, J.J. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9bwe | | Status: | HPUB -- hold until publication | | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine at pH 6.4 in an intermediate state | | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwj | | Status: | HPUB -- hold until publication | | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine and 0.1 mM zinc in an apo state | | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 8zkl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of vibrio cholerae phage VP1 capsid protein | | Authors: | Liu, H.R., Pang, H. | | Deposition date: | 2024-05-16 | | Release date: | 2025-05-16 |
|
| PDBID: | 8zjp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Drimenyl diphosphate synthase SsDMS_Y505I&D303A from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zg5 | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_Y505I&D303A from Streptomyces showdoensis (Apo) | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgv | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248A&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgw | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zg1 | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis (Apo) | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-08 |
|
| PDBID: | 7h63 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.65 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 4-[(5-fluoro-3-propan-2-yl-1H-indol-2-yl)-phenylmethyl]-3-hydroxy-2-propan-2-yl-1,2-dihydropyrrol-5-one (VINYLOGOUS ACID) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h65 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.8 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH N-[1-[2-[[2-hydroxy-3-methyl-3-(4-methylphenyl)-4-oxocyclobuten-1-yl]-phenylmethyl]-6-methyl-1H-indol-3-yl]-2-methylpropan-2-yl]acetamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9f0k | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a mammalian expression system | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9f02 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 envelope glycoprotein (BG505 gp140 SOSIP.664) trimer in complex with three copies of ELC07 broadly neutralizing antibody. | | Authors: | Hope, J., Alguel, Y., Nans, A., Cherepanov, P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9ez0 | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a yeast expression system. | | Authors: | Bahar, M.W., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8yye | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipase CTL (Caldibacillus Thermoamylovorans) | | Authors: | Pan, S.Y., Lan, D.M., Wang, Y.H. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b7y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of TetR regulator Mce3R from Mycobacterium tuberculosis bound to a DNA oligonucleotide | | Authors: | Panagoda, N., Sampson, N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ep2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-03-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8ypc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in phosphorylated state | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Pantothenate Synthetase from Candida albicans. | | Authors: | Regan, J., Avad, K.A., Alaidi, O., Seetharaman, J., Palmer, G.E., Hevener, K.E. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8yc1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Acid phosphate hydrolase from Shigella flexneri (apo) | | Authors: | Du, W.Y., Pan, X.M., Dong, L.B. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8s0v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Cryptosporidium parvum - Trypanosoma cruzi mutant lysyl tRNA synthetase in complex with inhibitor | | Authors: | Dawson, A., Wyllie, S. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8rvr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rtf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-01-26 |
|
