| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1 MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9vd0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of monomeric Suv3-ssRNA-AMPPNP complex | | Authors: | Patra, M., Yuan, H.S. | | Deposition date: | 2025-06-07 |
|
| PDBID: | 9vd1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Dimeric Suv3-ssRNA-AMPPNP complex | | Authors: | Patra, M., Yuan, H.S. | | Deposition date: | 2025-06-07 |
|
| PDBID: | 9oyi | | Status: | HPUB -- hold until publication | | Title: | Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped DNA in state 2 conformer 1 with fully open clamp and unsettled DNA | | Authors: | Zheng, F., Yao, Y.N., Georgescu, R., Lyu, M., O''Donnell, M.E., Li, H. | | Deposition date: | 2025-06-04 |
|
| PDBID: | 9v4e | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Gallus gallus c-Src Kinase Domain with Point mutation Y416D and Deletion of Residues N414, T417, and R419 Bound to AMP-PNP | | Authors: | Jain, P., Clifton, B.E., Laurino, P. | | Deposition date: | 2025-05-23 |
|
| PDBID: | 9or8 | | Status: | HOLD -- hold until a certain date | | Title: | Acetyl-CoA Synthetase (Acs1), G196E substitution with bound acetyl-AMP from Syntrophus aciditrophicus | | Authors: | Thomas, L.M., Yaghoubi, S., Karr, E.A. | | Deposition date: | 2025-05-21 | | Release date: | 2026-05-21 |
|
| PDBID: | 9or9 | | Status: | HOLD -- hold until a certain date | | Title: | Acetyl-CoA Synthetase (Acs1), G196ET197G substitution with bound acetyl-AMP from Syntrophus aciditrophicus | | Authors: | Thomas, L.M., Yaghoubi, S., Karr, E.A. | | Deposition date: | 2025-05-21 | | Release date: | 2026-05-21 |
|
| PDBID: | 9ora | | Status: | HOLD -- hold until a certain date | | Title: | Acetyl-CoA Synthetase (Acs1), D527P substitution with bound acetyl-AMP from Syntrophus aciditrophicus | | Authors: | Thomas, L.M., Yaghoubi, S., Karr, E.A. | | Deposition date: | 2025-05-21 | | Release date: | 2026-05-21 |
|
| PDBID: | 9orc | | Status: | HOLD -- hold until a certain date | | Title: | Acetyl-CoA Synthetase (SaAcs1), K202E substitution with bound acetyl-AMP from Syntrophus aciditrophicus | | Authors: | Thomas, L.M., Karr, E.A., Yaghuobi, S. | | Deposition date: | 2025-05-21 | | Release date: | 2026-05-21 |
|
| PDBID: | 9opk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IRAK4 with compound 1, an analog of KT-474 TBM | | Authors: | Fei, X., Ramanathan, A., Diagle, C., Ford, M., Campbell, V., Zheng, X., Li, H., Sintchak, M., Kamadurai, H., Miller, R., Kazmirski, S., Huang, X., Weiss, M., Manolfi, N., Zhu, X. | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9opj | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of IRAK4:KT-474:CRBN-DDB1 ternary complex | | Authors: | Fei, X., Ramanathan, A., Diagle, C., Ford, M., Campbell, V., Zheng, X., Li, H., Sintchak, M., Kamadurai, H., Miller, R., Kazmirski, S., Huang, X., Weiss, M., Manolfi, N., Zhu, X. | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9uly | | Status: | HPUB -- hold until publication | | Title: | crystal structure of AbGHMP in complex with L-Ara and AMPPNP | | Authors: | He, C., Li, F. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9qy5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of non-specific endoxylanase from Acetivibrio clariflavus (AcXyn30B), that belongs to subfamily GH30_12. | | Authors: | Karampa, P., Dimarogona, M., Pentari, C., Topakas, E. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9qx3 | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-clamp in complex with designed circular peptide | | Authors: | Simonsen, S., Zhao, J., Soegaard, K., Olsen, J.G., Otterlei, M., Rogers, J.M., Kragelund, B.B. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1 HHMKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL
>Entity 2 (DPN)VFVNLWYEGFS(CCS)(NH2)
|
|
| PDBID: | 9ugg | | Status: | HPUB -- hold until publication | | Title: | PsdAB dimer (peptidisc sample) | | Authors: | He, Y.T., Fan, W.J., Shao, K., Luo, M. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9o3a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o39 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the E. coli HtpG N-terminal and middle domain dimer in complex with AMPPNP | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9nzt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of OsCas12f-gRNA-DNA ternary complex State I | | Authors: | Guan, K., Ocampo, R.F., Taylor, D.W. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nzo | | Status: | HPUB -- hold until publication | | Title: | Structure of Cas12f-MG119-28 State I | | Authors: | Fregoso Ocampo, R., Guan, K., Taylor, D.W. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nzq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of OsCas12f-gRNA-DNA ternary complex. State II | | Authors: | Guan, K., Ocampo, R.F., Taylor, D.W. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nzp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of RhCas12f-gRNA-DNA ternary complex | | Authors: | Guan, K., Ocampo, R.F., Taylor, D.W. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qqf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqc | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic ON | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqg | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic OFF | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|