Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9p1q
Status:HPUB -- hold until publication
Title:Crystal structure of Ube2E3
Authors:Cook, M.W., Brzovic, P.S., Stenkamp, R.E.
Deposition date:2025-06-10
Sequence:

>Entity 1


MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
PDBID:9vd0
Status:HPUB -- hold until publication
Title:Cryo-EM structure of monomeric Suv3-ssRNA-AMPPNP complex
Authors:Patra, M., Yuan, H.S.
Deposition date:2025-06-07
PDBID:9vd1
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Dimeric Suv3-ssRNA-AMPPNP complex
Authors:Patra, M., Yuan, H.S.
Deposition date:2025-06-07
PDBID:9oyi
Status:HPUB -- hold until publication
Title:Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped DNA in state 2 conformer 1 with fully open clamp and unsettled DNA
Authors:Zheng, F., Yao, Y.N., Georgescu, R., Lyu, M., O''Donnell, M.E., Li, H.
Deposition date:2025-06-04
PDBID:9v4e
Status:HPUB -- hold until publication
Title:Crystal Structure of Gallus gallus c-Src Kinase Domain with Point mutation Y416D and Deletion of Residues N414, T417, and R419 Bound to AMP-PNP
Authors:Jain, P., Clifton, B.E., Laurino, P.
Deposition date:2025-05-23
PDBID:9or8
Status:HOLD -- hold until a certain date
Title:Acetyl-CoA Synthetase (Acs1), G196E substitution with bound acetyl-AMP from Syntrophus aciditrophicus
Authors:Thomas, L.M., Yaghoubi, S., Karr, E.A.
Deposition date:2025-05-21
Release date:2026-05-21
PDBID:9or9
Status:HOLD -- hold until a certain date
Title:Acetyl-CoA Synthetase (Acs1), G196ET197G substitution with bound acetyl-AMP from Syntrophus aciditrophicus
Authors:Thomas, L.M., Yaghoubi, S., Karr, E.A.
Deposition date:2025-05-21
Release date:2026-05-21
PDBID:9ora
Status:HOLD -- hold until a certain date
Title:Acetyl-CoA Synthetase (Acs1), D527P substitution with bound acetyl-AMP from Syntrophus aciditrophicus
Authors:Thomas, L.M., Yaghoubi, S., Karr, E.A.
Deposition date:2025-05-21
Release date:2026-05-21
PDBID:9orc
Status:HOLD -- hold until a certain date
Title:Acetyl-CoA Synthetase (SaAcs1), K202E substitution with bound acetyl-AMP from Syntrophus aciditrophicus
Authors:Thomas, L.M., Karr, E.A., Yaghuobi, S.
Deposition date:2025-05-21
Release date:2026-05-21
PDBID:9opk
Status:HPUB -- hold until publication
Title:Crystal structure of IRAK4 with compound 1, an analog of KT-474 TBM
Authors:Fei, X., Ramanathan, A., Diagle, C., Ford, M., Campbell, V., Zheng, X., Li, H., Sintchak, M., Kamadurai, H., Miller, R., Kazmirski, S., Huang, X., Weiss, M., Manolfi, N., Zhu, X.
Deposition date:2025-05-19
PDBID:9opj
Status:HPUB -- hold until publication
Title:cryoEM structure of IRAK4:KT-474:CRBN-DDB1 ternary complex
Authors:Fei, X., Ramanathan, A., Diagle, C., Ford, M., Campbell, V., Zheng, X., Li, H., Sintchak, M., Kamadurai, H., Miller, R., Kazmirski, S., Huang, X., Weiss, M., Manolfi, N., Zhu, X.
Deposition date:2025-05-19
PDBID:9uly
Status:HPUB -- hold until publication
Title:crystal structure of AbGHMP in complex with L-Ara and AMPPNP
Authors:He, C., Li, F.
Deposition date:2025-04-21
PDBID:9qy5
Status:HPUB -- hold until publication
Title:Crystal structure of non-specific endoxylanase from Acetivibrio clariflavus (AcXyn30B), that belongs to subfamily GH30_12.
Authors:Karampa, P., Dimarogona, M., Pentari, C., Topakas, E.
Deposition date:2025-04-17
PDBID:9qx3
Status:HPUB -- hold until publication
Title:E. coli beta-clamp in complex with designed circular peptide
Authors:Simonsen, S., Zhao, J., Soegaard, K., Olsen, J.G., Otterlei, M., Rogers, J.M., Kragelund, B.B.
Deposition date:2025-04-15
Sequence:

>Entity 1


HHMKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL

>Entity 2


(DPN)VFVNLWYEGFS(CCS)(NH2)
PDBID:9ugg
Status:HPUB -- hold until publication
Title:PsdAB dimer (peptidisc sample)
Authors:He, Y.T., Fan, W.J., Shao, K., Luo, M.
Deposition date:2025-04-11
PDBID:9o3a
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state
Authors:Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y.
Deposition date:2025-04-07
Release date:2026-04-07
PDBID:9o3c
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state
Authors:Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y.
Deposition date:2025-04-07
Release date:2026-04-07
PDBID:9o39
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Cryo-EM structure of the E. coli HtpG N-terminal and middle domain dimer in complex with AMPPNP
Authors:Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y.
Deposition date:2025-04-07
Release date:2026-04-07
PDBID:9nzt
Status:HPUB -- hold until publication
Title:Cryo-EM structure of OsCas12f-gRNA-DNA ternary complex State I
Authors:Guan, K., Ocampo, R.F., Taylor, D.W.
Deposition date:2025-04-01
PDBID:9nzo
Status:HPUB -- hold until publication
Title:Structure of Cas12f-MG119-28 State I
Authors:Fregoso Ocampo, R., Guan, K., Taylor, D.W.
Deposition date:2025-04-01
PDBID:9nzq
Status:HPUB -- hold until publication
Title:Cryo-EM structure of OsCas12f-gRNA-DNA ternary complex. State II
Authors:Guan, K., Ocampo, R.F., Taylor, D.W.
Deposition date:2025-04-01
PDBID:9nzp
Status:HPUB -- hold until publication
Title:Cryo-EM structure of RhCas12f-gRNA-DNA ternary complex
Authors:Guan, K., Ocampo, R.F., Taylor, D.W.
Deposition date:2025-04-01
PDBID:9qqf
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex
Authors:Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A.
Deposition date:2025-03-31
PDBID:9qqc
Status:HPUB -- hold until publication
Title:Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic ON
Authors:Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E.
Deposition date:2025-03-31
PDBID:9qqg
Status:HPUB -- hold until publication
Title:Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic OFF
Authors:Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E.
Deposition date:2025-03-31

246031

건을2025-12-10부터공개중

PDB statisticsPDBj update infoContact PDBjnumon