| PDBID: | 9h0h | | Status: | HPUB -- hold until publication | | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1-OPABACTIN-HAB1 TERNARY COMPLEX | | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9h0i | | Status: | HPUB -- hold until publication | | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1-iCB-HAB1 TERNARY COMPLEX | | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | | Deposition date: | 2024-10-08 |
|
| PDBID: | 9ju3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 3-fold Block-refine of Full particle of phiYY, a prokaryotic dsRNA virus | | Authors: | Meng, K.W., Cui, C.X., HuYan, Y.N., Zhang, X.Z., Meng, G. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9jua | | Status: | HPUB -- hold until publication | | Title: | The complex of Eny2B and Sgf11 of Drosophila melanogaster | | Authors: | Boyko, K.M., Bonchuk, A.N., Nikolaeva, A.Y., Arkova, O.V., Belova, E.V., Georgiev, P.G., Popov, V.O. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9dve | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of Kohinoor reversibly switchable fluorescent protein | | Authors: | Richardson, B.C., He, Y., Iuliano, J.N., Woroniecka, H.A., French, J.B. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h02 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CREBBP histone acetyltransferase domain in complex with a bisubstrate inhibitor, Lys-CoA | | Authors: | Mechaly, A.E., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9h01 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | nsp14 of SARS-CoV-2 in complex with a camelid nanobody | | Authors: | Gauffre, P., Ferron, F., Canard, B. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9gzq | | Status: | HPUB -- hold until publication | | Title: | Structure of ForCE lacking the Helical Membrane Plug-in (HMP; DUF1641) | | Authors: | Arnoux, P., Cherrier, M.V., Nicolet, Y., Legrand, P., Broc, M., Seduk, F., Arias-Cartin, R., Magalon, A., Walburger, A. | | Deposition date: | 2024-10-04 |
|
| PDBID: | 9jtf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human BAF155-BRG1 fusion protein | | Authors: | Hattori, N., Hamada, K., Oguni, A., Ogata, K., Ito, T. | | Deposition date: | 2024-10-04 |
|
| PDBID: | 9gyg | | Status: | HPUB -- hold until publication | | Title: | The structure of ornithine decarboxylase from Leishmania infantum in complex with PLP | | Authors: | Fiorillo, A., Antonelli, A., Ilari, A., Tria, G. | | Deposition date: | 2024-10-02 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMGDHDVALCHVSRYNHANYWAFVPLPTVSDDTGCDSLHHDSASERIRMAPPASASKAGAAEERLHPYERRLLDQYQIHLQPANRNPLSRADSAAGREETAQTPAQVQMVSGVAVADSTSDQHASVASSQDLVDLFFLEGSQAVDGLCFSPYPIYGWRTAEERRAAVCEVFKTYNVVTRLPASPAALAAAQRRYSRHRHSAIAPINKSAIETREQYWRRLSNLYTQKGVKDAASAADAAATTATNGAVPAAPAYEPEDPFYIIDLGRVVEQMARWRHELPMVRPYFAV(LLP)SNPQPAVLEVLSALGAGFDCASKEEIHMVLGRQLVASPDDIIFANPCKQLGDLREAQACGVTYVTVDNPLEMEKISRLMPSAHAIIRIKTNDSKAQCSFSTKFGAPLEDVEGLLEAARQFNVTVCGVSFHVGSGNDDQSAYVSAVRDAYQVFQQAVQYGFKCTILDIGGGFPGTEVVEGSGNTSFEAIARTIRPVLAELFGGGDVTIISEPGRYFTAASHALLMNVFASRTLRLSDVEVSRQAFQSVVSMDEPEEYQYYVNDGLYHSFNCILFDHAHPTLLLLNDGDGADGVESGTEAAAVCSEEEGETSLSGPLANDALFMSAWDRRRSFARRPLRITTIFGPTCDSMDCILKKQPFPEMKLGDWLLVPDMGSYTTAAAGFFNGFATRRLEWVSSVDLCARPRPVYTREGNTLRCVSE
|
|
| PDBID: | 9gyf | | Status: | HPUB -- hold until publication | | Title: | Ku70/80 with PAXX peptide mutation K193R | | Authors: | Chaplin, A.K., Malewicz, M. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9gym | | Status: | HPUB -- hold until publication | | Title: | Estructure of Arbitrium receptor | | Authors: | Gallego del Sol, F., Marina, A. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9jsr | | Status: | HPUB -- hold until publication | | Title: | 50S precursor - Erm complex (C-I) | | Authors: | Sengupta, S., Mukherjee, R., Pilsl, M., Bagale, S., Adhikary, A.D., Borkar, A., Pradeepkumar, P.I., Engel, C., Chowdhury, A., Kaushal, P.S., Anand, R. | | Deposition date: | 2024-10-01 |
|
| PDBID: | 9dtm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the wild-type native full-length HIV-1 capsid protein in complex with ZW-1514 | | Authors: | Kirby, K.A., Sarafianos, S.G. | | Deposition date: | 2024-10-01 |
|
| PDBID: | 9dto | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | N74D mutant of the HIV-1 capsid protein in complex with ZW-1261 | | Authors: | Kirby, K.A., Sarafianos, S.G. | | Deposition date: | 2024-10-01 |
|
| PDBID: | 9dtn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | N74D mutant of the HIV-1 capsid protein in complex with ZW-1514 | | Authors: | Kirby, K.A., Sarafianos, S.G. | | Deposition date: | 2024-10-01 |
|
| PDBID: | 9dt0 | | Status: | HOLD -- hold until a certain date | | Title: | Human SERF2 | | Authors: | Sahoo, B.R., Subramanian, V., Bardwell, J.C.A. | | Deposition date: | 2024-09-30 | | Release date: | 2025-09-30 |
|
| PDBID: | 9dsr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab MS-1805 in complex with NPNA3 peptide from circumsporozoite protein | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2024-09-28 |
|
| PDBID: | 9dsu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab 7088 in complex with N-terminal junction peptide from circumsporozoite protein | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2024-09-28 |
|
| PDBID: | 9dst | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab MS-1805 in complex with N-terminal junction peptide from circumsporozoite protein | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2024-09-28 |
|
| PDBID: | 9dss | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab 7088 in complex with NPNA3 peptide from circumsporozoite protein | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2024-09-28 |
|
| PDBID: | 9dse | | Status: | HPUB -- hold until publication | | Title: | Cyanide-ligated Bordetella pertussis globin coupled sensor regulatory domain | | Authors: | Hoque, N.J., Pope, S.R., Boal, A.K. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsf | | Status: | HPUB -- hold until publication | | Title: | Cyanide-ligated Bordetella pertussis globin coupled sensor regulatory domain S68A | | Authors: | Hoque, N.J., Pope, S.R., Boal, A.K. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9ds3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Apo-241_2F04 Fab | | Authors: | Lin, T.H., Wilson, I.A. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw6 | | Status: | HPUB -- hold until publication | | Title: | Lys9DabMC6*a 2-Delta | | Authors: | Maglio, O., Lombardi, A., Chino, M., Pirro, F. | | Deposition date: | 2024-09-26 |
|
