PDBID: | 9g1s | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 | Sequence: | >Entity 1 MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
PDBID: | 9g1u | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9g20 | Status: | HPUB -- hold until publication | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 310K | Authors: | Horvath, D. | Deposition date: | 2024-07-10 |
|
PDBID: | 9g25 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9g21 | Status: | HPUB -- hold until publication | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 321K | Authors: | Horvath, D. | Deposition date: | 2024-07-10 |
|
PDBID: | 9g22 | Status: | HPUB -- hold until publication | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bDR) at 277K | Authors: | Horvath, D. | Deposition date: | 2024-07-10 |
|
PDBID: | 9g28 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9g2d | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9g2e | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9g2h | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ipc | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ipd | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ipe | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ip8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ip9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ipa | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ipb | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ip7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ip6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-10 |
|
PDBID: | 9ip0 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-07-10 |
|
PDBID: | 9ioy | Status: | HPUB -- hold until publication | Title: | Isophthalate dioxygenase in complex with isophthalate | Authors: | Jangid, K., Mahto, J.K., Kumar, P. | Deposition date: | 2024-07-10 |
|
PDBID: | 9ip2 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of the RNA-dependent RNA polymerase complex from Marburg virus | Authors: | Li, G., Du, T., Ru, H. | Deposition date: | 2024-07-10 |
|
PDBID: | 9ip4 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of the RNA-dependent RNA polymerase complex from Marburg virus | Authors: | Li, G., Du, T., Ru, H. | Deposition date: | 2024-07-10 |
|
PDBID: | 9ipk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-10 | Release date: | 2025-07-10 |
|
PDBID: | 9ipi | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-07-10 | Release date: | 2025-07-10 |
|