| PDBID: | 9g3c | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperatures. 200 K data collection | | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3o | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase 24-pentamer spherical cage | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3p | | Status: | HOLD -- hold until a certain date | | Title: | Circularly permuted lumazine synthase 12-pentamer spherical cage | | Authors: | Koziej, L., Azuma, Y. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9g3u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperatures. Room temperature data collection | | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g42 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3k | | Status: | HPUB -- hold until publication | | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-07-12 | | Sequence: | >Entity 1
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
| PDBID: | 9g40 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the Open gamma-Tubulin Ring Complex from Pig Brain | | Authors: | Munoz-Hernandez, H., Wieczorek, M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9g3q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9ipz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of YEATS domain of human YEATS2 in complex with H3K27bf peptide | | Authors: | Yao, X.Y., Li, H.T. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9ipy | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iqf | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ADP-bound IFasym-4 (peptidisc) state | | Authors: | Lan, Y., Li, J. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9iqe | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ADP-bound IFasym-3 (peptidisc) state | | Authors: | Lan, Y., Li, J. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9iqh | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of sulfhydrylase | | Authors: | Li, X.J., Chen, L.X., Lin, J.Q. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9iqg | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ATP|ADP+Vi-bound Occ (Vi) state | | Authors: | Lan, Y., Jing, Y., Li, J. | | Deposition date: | 2024-07-12 | | Release date: | 2025-07-12 |
|
| PDBID: | 9iq4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq3 | | Status: | HPUB -- hold until publication | | Title: | AkaM,SnoaL-lile Protein | | Authors: | Zhang, B., Ma, X.X., Zhu, A., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iqa | | Status: | HPUB -- hold until publication | | Title: | structure of the oleate hydratase V206L-mutant from Staphylococcus aureus | | Authors: | Xue, S., Feng, T. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq5 | | Status: | HPUB -- hold until publication | | Title: | CatM, SnoaL-like protein | | Authors: | Zhang, B., Zhu, A., Ma, X.X., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
| PDBID: | 9iq7 | | Status: | HPUB -- hold until publication | | Title: | SacM-homologous of AkaM | | Authors: | Zhang, B., Ge, H.M. | | Deposition date: | 2024-07-12 |
|
