PDBID: | 9d8w | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of Human Enterovirus D94 A-particle | Authors: | Fu, J., Klose, T., Rossmann, M.R., Kuhn, R., Center for Structural Genomics of Infectious Diseases (CSGID) | Deposition date: | 2024-08-20 |
|
PDBID: | 9d8v | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the BG505 SOSIPv2 | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | Deposition date: | 2024-08-20 |
|
PDBID: | 9d91 | Status: | PROC -- to be processed | Title: | Crystal structure of L-asparaginase from Streptococcus pneumoniae TIGR4 | Authors: | Gade, P., Endres, M., Babnigg, G., Joachimiak, A. | Deposition date: | 2024-08-20 |
|
PDBID: | 9j85 | Status: | AUTH -- processed, waiting for author review and approval | Title: | The complex structure of okaE with a-ketoglutarate | Authors: | Liu, T.H., Yan, W.P. | Deposition date: | 2024-08-20 |
|
PDBID: | 9j7w | Status: | AUTH -- processed, waiting for author review and approval | Title: | Channel Rhodospin from Klebsormidium nitens (KnChR) | Authors: | Yuzhu, Z.W., Hiroaki, A., Tatsuki, T., Fumiya, K.S., Wataru, S., Osamu, N. | Deposition date: | 2024-08-20 |
|
PDBID: | 9d89 | Status: | AUTH -- processed, waiting for author review and approval | Title: | E. coli 50S ribosomal subunit in complex with PrAMP rumicidin-2 (focused refinement) | Authors: | Pichkur, E.B., Panteleev, P.V., Konevega, A.L. | Deposition date: | 2024-08-19 |
|
PDBID: | 9d8b | Status: | HPUB -- hold until publication | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the GDP-bound form | Authors: | Lee, M., Magante, K.D., Smith, A.T. | Deposition date: | 2024-08-19 |
|
PDBID: | 9d8c | Status: | AUTH -- processed, waiting for author review and approval | Title: | OXA-58-NA-1-157 2.5 hour complex | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | Deposition date: | 2024-08-19 |
|
PDBID: | 9d8d | Status: | HPUB -- hold until publication | Title: | Crystal structure of Vibrio cholerae NFeoB in the GMPPCP-bound form | Authors: | Lee, M., Magante, K.D., Smith, A.T. | Deposition date: | 2024-08-19 |
|
PDBID: | 9gio | Status: | HPUB -- hold until publication | Title: | Crystal structure of the VHL-EloC-EloB complex with a covalent compound bound to C77 of VHL. | Authors: | Collie, G.W. | Deposition date: | 2024-08-19 |
|
PDBID: | 9j7h | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from Providencia alcalifaciens complexed with quinic acid | Authors: | Jangid, K., Mahto, J.K., Kumar, K.A., Kumar, P. | Deposition date: | 2024-08-19 |
|
PDBID: | 9d7y | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of scFv corresponding to human autoantibody b96.11 | Authors: | Buckle, A.M., McGowan, S. | Deposition date: | 2024-08-18 | Release date: | 2025-08-18 |
|
PDBID: | 9d7r | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Fva1 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | Deposition date: | 2024-08-17 |
|
PDBID: | 9d7s | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.85A resolution | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | Deposition date: | 2024-08-17 |
|
PDBID: | 9d7t | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api137 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | Deposition date: | 2024-08-17 |
|
PDBID: | 9d79 | Status: | AUTH -- processed, waiting for author review and approval | Title: | OXA-58-NA-1-157 1.5 min complex | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | Deposition date: | 2024-08-16 |
|
PDBID: | 9d7a | Status: | AUTH -- processed, waiting for author review and approval | Title: | OXA-58-NA-1-157 5 min complex | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | Deposition date: | 2024-08-16 |
|
PDBID: | 9d7b | Status: | AUTH -- processed, waiting for author review and approval | Title: | OXA-58-NA-1-157 7.5 min complex | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | Deposition date: | 2024-08-16 |
|
PDBID: | 9d7d | Status: | AUTH -- processed, waiting for author review and approval | Title: | OXA-58-NA-1-157 20 min complex | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | Deposition date: | 2024-08-16 |
|
PDBID: | 9d70 | Status: | HPUB -- hold until publication | Title: | Cryo-EM of helical fibers formed by two peptides Pyn-K6 and Pyn-(EY)3 | Authors: | Zia, A., Qiao, Y., Xu, B., Wang, F. | Deposition date: | 2024-08-16 |
|
PDBID: | 9d78 | Status: | AUTH -- processed, waiting for author review and approval | Title: | apo-OXA-58 | Authors: | Maggiolo, A.O., Smith, C.A., Toth, M., Vakulenko, S.B. | Deposition date: | 2024-08-16 |
|
PDBID: | 9d7j | Status: | HPUB -- hold until publication | Title: | Clostridium acetobutylicum alcohol dehydrogenase bound to NADP+ | Authors: | Madzelan, P., Wilson, M.A. | Deposition date: | 2024-08-16 | Sequence: | >Entity 1 (MSE)GSSHHHHHHSSGLVPRGSH(MSE)KEYKYTVITGASSGIGYEAAKAFAKRGKNLIIIARRREKLEELKKEILHYNRSLKVIVKSIDLSITSNVYSLYDELKNYNIETLVNNAGFGDYSKVNNQNLEKVES(MSE)LSLNIEALVILSSLFVRDYEKIEGTQLINISSAGGYTIVPNAVIYCATKFFVSSFTEGLARELIEAKSNLKAKVLAPAATETEFGKVASDVKEYDYQEKFHKYHTSKQ(MSE)AEFLIKLYDNDYIVGKVDRNSFKFTLQNPIFDYA
|
|
PDBID: | 9d7c | Status: | AUTH -- processed, waiting for author review and approval | Title: | OXA-58-NA-1-157 10 min complex | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | Deposition date: | 2024-08-16 |
|
PDBID: | 9gi1 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of the S.aureus MecA/ClpC/ClpP degradation system | Authors: | Azinas, S., Wallden, K., Katikaridis, P., Schahl, A., Mogk, A., Carroni, M. | Deposition date: | 2024-08-16 |
|
PDBID: | 9ghx | Status: | HPUB -- hold until publication | Title: | Lysozyme covalently bound to fac-[Re(CO)3-imidazole] complex, incubated for 112 weeks. Data collection done at mammalian body temperature. | Authors: | Jacobs, F.J.F., Brink, A., Helliwell, J.R. | Deposition date: | 2024-08-16 |
|