| PDBID: | 8y5p | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-B state 4 (subclass 1) containing mRNA with 24-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8y5o | | Status: | HOLD -- hold until a certain date | | Title: | E.coli transcription translation coupling complex in TTC-B state 3 (subclass1) containing mRNA with 30-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 | | Release date: | 2025-07-31 |
|
| PDBID: | 8rtu | | Status: | HPUB -- hold until publication | | Title: | TaGST-10 in complex with deoxynivalenol-13-glutathione | | Authors: | Michlmayr, H., Papageorgiou, A.C. | | Deposition date: | 2024-01-29 | | Release date: | 2025-07-29 |
|
| PDBID: | 8vrp | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | | Authors: | Goldstone, D.C., Walsham, L. | | Deposition date: | 2024-01-22 | | Release date: | 2025-07-21 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8voo | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 39 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 | | Release date: | 2025-07-16 |
|
| PDBID: | 8vop | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation coupled complex (TTC-B) containing mRNA with a 36 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 | | Release date: | 2025-07-16 |
|
| PDBID: | 8voq | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 39 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 | | Release date: | 2025-07-16 |
|
| PDBID: | 8vor | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 51 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 | | Release date: | 2025-07-16 |
|
| PDBID: | 8vl1 | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 36 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-07-16 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8x9z | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | P-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8r77 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Ficin C crystal form 2 | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8uxa | | Status: | HPUB -- hold until publication | | Title: | Glucose treated mitochondrial ribosome of saccharomyces cerevisiae class I | | Authors: | Yu, Z., Zheng, F., Zhou, C. | | Deposition date: | 2023-11-09 | | Release date: | 2025-11-12 |
|
| PDBID: | 8ux4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mitochondrial ribosome of saccharomyces cerevisiae class II from YEP with Dextrose culture | | Authors: | Yu, Z., Zheng, F., Zhou, C. | | Deposition date: | 2023-11-08 | | Release date: | 2025-10-31 |
|
| PDBID: | 8qza | | Status: | HPUB -- hold until publication | | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | | Deposition date: | 2023-10-26 | | Release date: | 2025-07-26 |
|
| PDBID: | 8tt8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8sup | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the 48S translation initiation complex assembled on the encephalomyocarditis virus IRES | | Authors: | Bhattacharjee, S., Abaeva, I.S., Brown, Z.P., Arhab, Y., Fallah, H., Jeevan, J.C., Hellen, C.U.T., Frank, J., Pestova, T.V. | | Deposition date: | 2023-05-12 |
|
| PDBID: | 8se3 | | Status: | HPUB -- hold until publication | | Title: | Structure of Full-length Human Protein Kinase C Beta 1 (PKCBI) in the Active Conformation | | Authors: | Cong, A.T.Q., Witter, T.L., Bruinsma, E.S., Jayaraman, S., Hawse, J.R., Goetz, M.P., Schellenberg, M.J. | | Deposition date: | 2023-04-07 | | Release date: | 2024-10-07 |
|
| PDBID: | 7r2n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | elongated Cascade complex from type I-A CRISPR-Cas system in an active state | | Authors: | Hu, C., Ni, D., Nam, K.H., Terns, M., Stahlberg, H. | | Deposition date: | 2022-02-04 |
|
| PDBID: | 7su5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Dihydroneopterin aldolase (DHNA) from Yersinia pestis co-crystallized with 6-biopterin | | Authors: | Bourne, C.R. | | Deposition date: | 2021-11-16 |
|
| PDBID: | 7n9p | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with ICI164,384 | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 7n9m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with Aliphatic SERD S-C10(13) | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 7n9n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with Aliphatic SERD S-C10(14) | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 2m95 | | Status: | POLC -- waiting for a policy decision | | Title: | Ferredoxin Competes with Bacterial Frataxin in Binding to the Desulfurase IscS | | Authors: | Konarev, P.V., Iannuzzi, C., Adinolfi, S., Roche, B., Kelly, G., Simon, L., Martin, S.R., Py, B., Barras, F., Svergun, D.I. | | Deposition date: | 2013-06-03 |
|
| PDBID: | 2m4b | | Status: | POLC -- waiting for a policy decision | | Title: | NMR data-driven model of GTPase Rheb-GTP tethered to a lipid-bilayer nanodisc | | Authors: | Mazhab-Jafari, M.T., Stathopulos, P.B., Marshall, C.B., Kobashigawa, Y., Stambolic, V., Kay, L.E., Inagaki, F., Ikura, M. | | Deposition date: | 2013-02-03 |
|
