| PDBID: | 9dsh | | Status: | PROC -- to be processed | | Title: | Crystal structure of the cow antibody P7 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsj | | Status: | PROC -- to be processed | | Title: | Crystal structure of the cow antibody 105 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsk | | Status: | PROC -- to be processed | | Title: | Crystal structure of the cow antibody 115 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsl | | Status: | PROC -- to be processed | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanide-ligated Bordetella pertussis globin coupled sensor regulatory domain S68A | | Authors: | Hoque, N.J., Pope, S.R., Boal, A.K. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsi | | Status: | PROC -- to be processed | | Title: | Crystal structure of the cow antibody 99 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9gvx | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1e conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gvy | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1m conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gvz | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1j conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gw0 | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1l conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gw3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gwj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9gw9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-26 |
|
