| PDBID: | 8tl5 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HIV-1 BG505DS-SOSIP.664 ENV TRIMER BOUND TO HERH-c.01 FAB | | Authors: | Pletnev, S., Hoyt, F., Fischer, E., Kwong, P. | | Deposition date: | 2023-07-26 |
|
| PDBID: | 8tl2 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HIV-1 BG505DS-SOSIP.664 ENV TRIMER BOUND TO DJ85-c.01 FAB | | Authors: | Pletnev, S., Hoyt, F., Fischer, E., Kwong, P. | | Deposition date: | 2023-07-26 |
|
| PDBID: | 8tio | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 with C tail extended by 12 glycines phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8pvy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound FX-171-C | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-18 | | Release date: | 2025-01-18 |
|
| PDBID: | 8pru | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Engineered form of T thermophiles AHIR | | Authors: | Roberts, M., Powell, A., Lewis, C., Sinclair, J. | | Deposition date: | 2023-07-12 |
|
| PDBID: | 8tg0 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the cold shock domain of the Arabidopsis thaliana glycine-rich protein AtGRP2 | | Authors: | Pougy, K.C., Almeida, F.C.L., Pinheiro, A.S. | | Deposition date: | 2023-07-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8tft | | Status: | HPUB -- hold until publication | | Title: | Fab of O13-1 human IgG1 antibody bound to IgV domain of human TIM-3 | | Authors: | Oganesyan, V.Y., van Dyk, N., Mazor, Y., Yang, C. | | Deposition date: | 2023-07-11 |
|
| PDBID: | 8jzp | | Status: | HOLD -- hold until a certain date | | Title: | Structure of mouse C5a-human C5aR1-Go complex | | Authors: | Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C. | | Deposition date: | 2023-07-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8pnf | | Status: | HPUB -- hold until publication | | Title: | HRV B14 virion proteins | | Authors: | Gil-Cantero, D., Mata, C.P., Mateu, M.G., Caston, J.R. | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 8tbc | | Status: | HPUB -- hold until publication | | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-28 |
|
| PDBID: | 8tbb | | Status: | HPUB -- hold until publication | | Title: | F9S, novel TIM-3 targeting antibody, bound to IgV domain of TIM-3 | | Authors: | Oganesyan, V., van Dyk, N., Mazor, Y., Yang, C. | | Deposition date: | 2023-06-28 |
|
| PDBID: | 8tac | | Status: | HPUB -- hold until publication | | Title: | Designed DNA binding protein | | Authors: | Doyle, L., Stoddard, B.L., Glasscock, C.J., McHugh, R.P., Pecoraro, R.J. | | Deposition date: | 2023-06-27 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8t68 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of the SET Domain of Human Histone-Lysine N-Methyltransferase SUV420H1 in complex with RQ3-111 | | Authors: | Zeng, H., Dong, A., Brown, P.J., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-06-15 |
|
| PDBID: | 8jqi | | Status: | HPUB -- hold until publication | | Title: | Cryo EM map of full length PLC gamma 2 and FGFR1 Kinase Domain | | Authors: | Shin, Y.-C., Liao, M. | | Deposition date: | 2023-06-14 | | Release date: | 2024-12-14 |
|
| PDBID: | 8jq0 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of ZBTB48 ZF10-11-C in complex with CIITA promoter | | Authors: | Li, F.D., Wang, S.M. | | Deposition date: | 2023-06-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8pa0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex | | Authors: | Wang, Z., Benesch, J.L.P., Allison, T.M., Song, H., McDonough, M.A., Brem, J., Rabe, P. | | Deposition date: | 2023-06-06 |
|
| PDBID: | 8p9a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 80S yeast ribosome in complex with Methyllissoclimide | | Authors: | Terrosu, S., Yusupov, M., Vanderwal, C. | | Deposition date: | 2023-06-05 |
|
| PDBID: | 8jl2 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SE_A277 variant at pH 9.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jl5 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 4.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jl6 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 5.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jl7 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 8.0 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jlt | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 7.0 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jlu | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 8.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jll | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 9.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
