| PDBID: | 8ula | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Lmo2839 ABC transporter substrate binding protein | | Authors: | Ripley, B.M., Radoshevich, L. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-15 |
|
| PDBID: | 8ulu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 04_A06 and PGDM1400 Fabs | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-15 |
|
| PDBID: | 8ul6 | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T16, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul8 | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T15, short soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulb | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T17, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulc | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T15, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws0 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human NEK7 S195D mutant | | Authors: | Bijpuria, S., Athresh, S., Subbiah, R., Mollard, A., Bearss, D. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrs | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 5 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrv | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wru | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws7 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1 with 10 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrt | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1/crRNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws6 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1 with 14 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws5 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1-N2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrw | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1-N1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrp | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 20 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 10 nt complementary heteroduplex | | Authors: | Zhang, X., Zhang, K. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrq | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 14 nt complementary heteroduplex | | Authors: | Zhang, K., Zhang, X. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws8 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human NEK7 D161N mutant | | Authors: | Bijpuria, S., Kanavalli, M., Subbiah, R., Mollard, A., Bearss, D. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8uko | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8ukn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8ukp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8wrf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MexL | | Authors: | Wei, Y., Wu, Z.K. | | Deposition date: | 2023-10-14 | | Release date: | 2025-04-14 | | Sequence: | >Entity 1
GSHMDPAKREAILEAAKRLFLCNGYDGSSMEAIASEAGVSKLTVYSHFTDKETLFSEAVKAKCAEQLPALYFQLAEGAPLEKVLLNIARGFHRLINSHEAIALTRLMAAQAGQNPKLSELFFEAGPKQVIDEMERLLEQARRSGKLAFPDARHAAEHFFMLVKGCANYRLLIGCAEPLDEAEGERHVEEVVALFLRAFAAGG
|
|
| PDBID: | 8qtv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 | | Release date: | 2025-04-13 |
|
