| PDBID: | 9dfd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with lasso peptide lariocidin B, mRNA, aminoacylated A-site Phe-tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.60A resolution | | Authors: | Aleksandrova, E.V., Travin, D.Y., Jangra, M., Kaur, M., Darwish, L., Koteva, K., Klepacki, D., Wang, W., Tiffany, M., Sokaribo, A., Coombes, B.K., Vazquez-Laslop, N., Wright, G.D., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9dfe | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with lasso peptide lariocidin and protein Y at 2.60A resolution | | Authors: | Aleksandrova, E.V., Travin, D.Y., Jangra, M., Kaur, M., Darwish, L., Koteva, K., Klepacki, D., Wang, W., Tiffany, M., Sokaribo, A., Coombes, B.K., Vazquez-Laslop, N., Wright, G.D., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9df5 | | Status: | HPUB -- hold until publication | | Title: | Human norovirus GII.3 protease | | Authors: | Pham, S.H., Neetu, N., Sankaran, B., Prasad, B.V.V. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9jc6 | | Status: | HOLD -- hold until a certain date | | Title: | Human H2BW2 nucleosome | | Authors: | Ding, D.B., Ishibashi, T., Nguyen, T.T. | | Deposition date: | 2024-08-28 | | Release date: | 2025-08-28 |
|
| PDBID: | 9ddr | | Status: | HPUB -- hold until publication | | Title: | Ternary substrate complex of DNA polymerase iota with DNA (template A), Ca2+, and dTTP | | Authors: | Frevert, Z., Reusch, D., Freudenthal, B., Washington, M.T. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9ddt | | Status: | PROC -- to be processed | | Title: | AAGAB pseudoGTPase domain in complex with AP-1 clathrin adaptor complex sigma 3 subunit | | Authors: | Wang, B., Tian, Y., Yin, Q. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9dds | | Status: | PROC -- to be processed | | Title: | Crystal structure of human AAGAB G domain with E144K mutation | | Authors: | Wang, B., Tian, Y., Yin, Q. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9glf | | Status: | HOLD -- hold until a certain date | | Title: | Anthraquinone Pigment Production Regulated by Cinnamic Acid | | Authors: | Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 | | Sequence: | >Entity 1
GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
|
|
| PDBID: | 9ddb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of gB-Ecto.516P.531E, a prefusion-stabilized HSV-1 glycoprotein B extracellular domain | | Authors: | Roark, R.S., Shapiro, L., Kwong, P.D. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gl2 | | Status: | HPUB -- hold until publication | | Title: | Befiradol-bound serotonin 5-HT1A receptor - Gs Protein Complex | | Authors: | Schneider, J., Gmeiner, P., Boettcher, B., Rasmussen, T. | | Deposition date: | 2024-08-26 |
|
| PDBID: | 9gkr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of artificial enzyme LmrR_pAF variant RMH in crystal form 1 | | Authors: | Thunnissen, A.M.W.H., Leveson-Gower, R.B., Rozeboom, H.J., Roelfes, G. | | Deposition date: | 2024-08-26 |
|
| PDBID: | 9gks | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of artificial enzyme LmrR_pAF variant RMH in crystal form 2 | | Authors: | Thunnissen, A.M.W.H., Leveson-Gower, R.B., Rozeboom, H.J., Roelfes, G. | | Deposition date: | 2024-08-26 |
|
| PDBID: | 9gkt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of artificial enzyme LmrR_pAF variant RGN | | Authors: | Thunnissen, A.M.W.H., Leveson-Gower, R.B., Rozeboom, H.J., Roelfes, G. | | Deposition date: | 2024-08-26 |
|
| PDBID: | 9gkj | | Status: | HPUB -- hold until publication | | Title: | Human TPC2 in Complex with Agonist and Metal Ion | | Authors: | Specht, T., Mayer, B., Fu, L., Urbansky, K., Madej, M.G., Ziegler, C. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9dcb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Structure of AAV5 at 4 Degrees | | Authors: | Bennett, A.B., McKenna, R. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9dcc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Structure of AAV5 at 55 Degrees Celsius | | Authors: | Bennett, A.B., McKenna, R. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9ja8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human phosphodiesterase 10A in complex with N-(2-amino-2-thioxoethyl)-2-(3-(3-(dimethylcarbamoyl)-6-fluoroimidazo[1,2-a]pyridin-2-yl)azetidin-1-yl)quinoline-4-carboxamide | | Authors: | Zhang, F.C., Huang, Y.Y., Luo, H.B., Guo, L. | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9dbk | | Status: | PROC -- to be processed | | Title: | Structure of a human apo ion channel | | Authors: | Neumann, B., McCarthy, S., Gonen, S. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbl | | Status: | PROC -- to be processed | | Title: | Structure of a human apo ion channel, class I | | Authors: | Neumann, B., McCarthy, S., Gonen, S. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbm | | Status: | PROC -- to be processed | | Title: | Structure of a human apo ion channel, class II | | Authors: | Neumann, B., McCarthy, S., Gonen, S. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbn | | Status: | PROC -- to be processed | | Title: | Structure of a human ion channel in complex with an inhibitory peptide | | Authors: | Neumann, B., McCarthy, S., Gonen, S. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dao | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | AlphaIIbbeta3 in fully-extended conformation in complex with R6H8 Fab | | Authors: | Walz, T., Coller, B.S., Wang, J.L., Buitrago, L., Wang, L., Li, J.H. | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9daj | | Status: | HPUB -- hold until publication | | Title: | Human norovirus GII.4 Sydney protease in complex with rupintrivir | | Authors: | Pham, S.H., Neetu, N., Sankaran, B., Prasad, B.V.V. | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9dal | | Status: | HPUB -- hold until publication | | Title: | Human norovirus GII.3 R112A mutant protease in complex with rupintrivir | | Authors: | Pham, S.H., Neetu, N., Sankaran, B., Prasad, B.V.V. | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9dap | | Status: | HPUB -- hold until publication | | Title: | Human norovirus GII.3 protease in complex with rupintrivir | | Authors: | Pham, S.H., Neetu, N., Sankaran, B., Prasad, B.V.V. | | Deposition date: | 2024-08-22 |
|
