PDBID: | 8qgl | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgm | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgn | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgo | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgc | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qge | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qga | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgg | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qfa | Status: | HPUB -- hold until publication | Title: | Solution structure of the extreme C-terminus of the Bordetella pertussis filamentous hemagglutinin prodomain | Authors: | Jurnecka, D., Chmelik, J., Bumba, L. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8h | Status: | HPUB -- hold until publication | Title: | 2-Ketoglutarate-Dependent Dioxygenase | Authors: | Zheng, C.N., Wei, W.Q. | Deposition date: | 2023-09-02 |
|
PDBID: | 8u1h | Status: | HPUB -- hold until publication | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | Deposition date: | 2023-09-01 |
|
PDBID: | 8w7r | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | H. walsbyi bacteriorhodopsin mutant - W94F | Authors: | Li, G.Y., Chen, J.C., Yang, C.S. | Deposition date: | 2023-08-31 | Release date: | 2024-08-31 |
|
PDBID: | 8w6w | Status: | HPUB -- hold until publication | Title: | Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2 in complex with ampicillin | Authors: | Dhaka, P., Mahto, J.K., Tomar, S., Kumar, P. | Deposition date: | 2023-08-30 |
|
PDBID: | 8tzy | Status: | HPUB -- hold until publication | Title: | CryoEM structure of non-neutralizing bivalent antibody CBH-4B in complex with Hepatitis C virus envelope glycoprotein E2 | Authors: | Shahid, S., Liqun, J., Liu, Y., Hasan, S.S., Mariuzza, R.A. | Deposition date: | 2023-08-28 |
|
PDBID: | 8txu | Status: | HPUB -- hold until publication | Title: | Fab 3864-10 in complex with influenza HA H3-SING16 | Authors: | Morano, N.C., Shapiro, L. | Deposition date: | 2023-08-24 |
|
PDBID: | 8txk | Status: | HPUB -- hold until publication | Title: | KRAS 1-169 G12C Mutant at 240k | Authors: | Deck, S.L., Xu, M., Milano, S.K., Aplin, C. | Deposition date: | 2023-08-23 |
|
PDBID: | 8qaj | Status: | HPUB -- hold until publication | Title: | NMR solution structure of C-terminal domain of CDNF | Authors: | Tossavainen, H., Permi, P. | Deposition date: | 2023-08-22 |
|
PDBID: | 8khv | Status: | HPUB -- hold until publication | Title: | The crystal structure of glycosaminoglycan lyase GAGase II | Authors: | Wei, L., Cao, H.Y., Li, F.C. | Deposition date: | 2023-08-22 |
|
PDBID: | 8tx3 | Status: | HPUB -- hold until publication | Title: | Fab 3864-6 in complex with influenza HA H3-VIC11 | Authors: | Morano, N.C., Shapiro, L. | Deposition date: | 2023-08-22 |
|
PDBID: | 8twn | Status: | HPUB -- hold until publication | Title: | Crystal structure of nitrile synthase AetD with substrate bound | Authors: | Ye, N., Drennan, C.L. | Deposition date: | 2023-08-21 |
|
PDBID: | 8twt | Status: | HPUB -- hold until publication | Title: | Crystal structure of nitrile synthase AetD with substrate bound and cofactor partially assembled | Authors: | Ye, N., Drennan, C.L. | Deposition date: | 2023-08-21 |
|
PDBID: | 8tww | Status: | HPUB -- hold until publication | Title: | Crystal structure of nitrile synthase AetD with substrate bound and cofactor fully assembled | Authors: | Ye, N., Drennan, C.L. | Deposition date: | 2023-08-21 |
|
PDBID: | 8q8i | Status: | HPUB -- hold until publication | Title: | AO75L in complex with a synthetic trisaccharide acceptor. | Authors: | Laugueri, M.E., Speciale, I., Gimeno, A., Sicheng, L., Poveda, A., Lowary, T., Van Etten J, L., Barbero, J., De Castro, C., Tonetti, M., Rojas A, L. | Deposition date: | 2023-08-18 |
|
PDBID: | 8q7g | Status: | HPUB -- hold until publication | Title: | Human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol pH 7.0 | Authors: | Angeli, A., Ferraroni, M. | Deposition date: | 2023-08-16 | Sequence: | >Entity 1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8kfq | Status: | HPUB -- hold until publication | Title: | The crystal structure of EGFR(T797M/L858R) with small molecule inhibitor B6 | Authors: | Wu, C., Ouyang, L. | Deposition date: | 2023-08-16 |
|