Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8qgl
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgm
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgn
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgo
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgc
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qge
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qga
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qgg
Status:HPUB -- hold until publication
Title:Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative
Authors:Gelin, M., Labesse, G., Lionne, C.
Deposition date:2023-09-05
PDBID:8qfa
Status:HPUB -- hold until publication
Title:Solution structure of the extreme C-terminus of the Bordetella pertussis filamentous hemagglutinin prodomain
Authors:Jurnecka, D., Chmelik, J., Bumba, L.
Deposition date:2023-09-04
PDBID:8w8h
Status:HPUB -- hold until publication
Title:2-Ketoglutarate-Dependent Dioxygenase
Authors:Zheng, C.N., Wei, W.Q.
Deposition date:2023-09-02
PDBID:8u1h
Status:HPUB -- hold until publication
Title:Axle-less Bacillus sp. PS3 F1 ATPase mutant
Authors:Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G.
Deposition date:2023-09-01
PDBID:8w7r
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:H. walsbyi bacteriorhodopsin mutant - W94F
Authors:Li, G.Y., Chen, J.C., Yang, C.S.
Deposition date:2023-08-31
Release date:2024-08-31
PDBID:8w6w
Status:HPUB -- hold until publication
Title:Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2 in complex with ampicillin
Authors:Dhaka, P., Mahto, J.K., Tomar, S., Kumar, P.
Deposition date:2023-08-30
PDBID:8tzy
Status:HPUB -- hold until publication
Title:CryoEM structure of non-neutralizing bivalent antibody CBH-4B in complex with Hepatitis C virus envelope glycoprotein E2
Authors:Shahid, S., Liqun, J., Liu, Y., Hasan, S.S., Mariuzza, R.A.
Deposition date:2023-08-28
PDBID:8txu
Status:HPUB -- hold until publication
Title:Fab 3864-10 in complex with influenza HA H3-SING16
Authors:Morano, N.C., Shapiro, L.
Deposition date:2023-08-24
PDBID:8txk
Status:HPUB -- hold until publication
Title:KRAS 1-169 G12C Mutant at 240k
Authors:Deck, S.L., Xu, M., Milano, S.K., Aplin, C.
Deposition date:2023-08-23
PDBID:8qaj
Status:HPUB -- hold until publication
Title:NMR solution structure of C-terminal domain of CDNF
Authors:Tossavainen, H., Permi, P.
Deposition date:2023-08-22
PDBID:8khv
Status:HPUB -- hold until publication
Title:The crystal structure of glycosaminoglycan lyase GAGase II
Authors:Wei, L., Cao, H.Y., Li, F.C.
Deposition date:2023-08-22
PDBID:8tx3
Status:HPUB -- hold until publication
Title:Fab 3864-6 in complex with influenza HA H3-VIC11
Authors:Morano, N.C., Shapiro, L.
Deposition date:2023-08-22
PDBID:8twn
Status:HPUB -- hold until publication
Title:Crystal structure of nitrile synthase AetD with substrate bound
Authors:Ye, N., Drennan, C.L.
Deposition date:2023-08-21
PDBID:8twt
Status:HPUB -- hold until publication
Title:Crystal structure of nitrile synthase AetD with substrate bound and cofactor partially assembled
Authors:Ye, N., Drennan, C.L.
Deposition date:2023-08-21
PDBID:8tww
Status:HPUB -- hold until publication
Title:Crystal structure of nitrile synthase AetD with substrate bound and cofactor fully assembled
Authors:Ye, N., Drennan, C.L.
Deposition date:2023-08-21
PDBID:8q8i
Status:HPUB -- hold until publication
Title:AO75L in complex with a synthetic trisaccharide acceptor.
Authors:Laugueri, M.E., Speciale, I., Gimeno, A., Sicheng, L., Poveda, A., Lowary, T., Van Etten J, L., Barbero, J., De Castro, C., Tonetti, M., Rojas A, L.
Deposition date:2023-08-18
PDBID:8q7g
Status:HPUB -- hold until publication
Title:Human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol pH 7.0
Authors:Angeli, A., Ferraroni, M.
Deposition date:2023-08-16
Sequence:

>Entity 1


MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
PDBID:8kfq
Status:HPUB -- hold until publication
Title:The crystal structure of EGFR(T797M/L858R) with small molecule inhibitor B6
Authors:Wu, C., Ouyang, L.
Deposition date:2023-08-16

223532

건을2024-08-07부터공개중

PDB statisticsPDBj update infoContact PDBjnumon