| PDBID: | 9ky2 | | Status: | HPUB -- hold until publication | | Title: | Structure of beta-arrestin2 in complex with mouse C5aR1pp | | Authors: | Banerjee, R., Yadav, R., Yadav, M.K., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-07 |
|
| PDBID: | 9kwx | | Status: | HPUB -- hold until publication | | Title: | Structure of mouse C5a-desArg bound mouse C5aR1 in complex with Go | | Authors: | Banerjee, R., Yadav, M.K., Yadav, R., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9kx6 | | Status: | HPUB -- hold until publication | | Title: | Structure of human C5a-desArg bound mouse C5aR1 in complex with Go | | Authors: | Banerjee, R., Yadav, M.K., Yadav, R., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9kvo | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D132E | | Authors: | Liu, C. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9kwg | | Status: | HPUB -- hold until publication | | Title: | Structure of mouse C5a bound mouse C5aR1 in complex with Go | | Authors: | Banerjee, R., Yadav, M.K., Yadav, R., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9kvw | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structures of Keap1-compound complexes | | Authors: | Zhuang, C.L., Yu, R.L. | | Deposition date: | 2024-12-05 | | Release date: | 2025-12-05 |
|
| PDBID: | 9md8 | | Status: | HPUB -- hold until publication | | Title: | Hip1 complex with inhibitor #2 (Hip1-2) via Ser228 | | Authors: | Yim, M.K., Schumann, N.C., Goldfarb, N.E., Johnson, S.J. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9md7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Hip1 complex with inhibitor #1 (Hip1-1) via Ser228 | | Authors: | Yim, M.K., Olsen, K.J., Brooks, C.L., Pena, K.J., Johnson, S.J., Goldfarb, N.E. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9hkr | | Status: | HPUB -- hold until publication | | Title: | NMR structure of the C-terminal domain of the human SPAG1 protein | | Authors: | Chagot, M.E., Quinternet, M. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kva | | Status: | HPUB -- hold until publication | | Title: | ECR CK PROTEIN | | Authors: | Kulakman, C., DeMirci, H., Wakatsuki, S., Mathews, I. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kun | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ligand-free trypanosome alternative oxidase | | Authors: | Ebiloma, G.U., Balogun, E.O., Dardonville, C., Shiba, T., De Koning, H.P. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kuu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D130G | | Authors: | Liu, C. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kv1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation E141G | | Authors: | Liu, C. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kvb | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin | | Authors: | Liu, C. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hkl | | Status: | HPUB -- hold until publication | | Title: | BetP-M150E in complex with GABA in an inward-facing state | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hkm | | Status: | HPUB -- hold until publication | | Title: | Transient activated state of BetP-M150E | | Authors: | Urbansky, K., Gauthier-Manuel, L., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hko | | Status: | HPUB -- hold until publication | | Title: | Downregulated closed state of BetP in complex with betaine | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kud | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 JN.1 variant RBD complexed with squirrel ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku7 | | Status: | HPUB -- hold until publication | | Title: | complex structure of methyltransferases SMYD2 and inhibitor (17) | | Authors: | Sun, Y.L., Lu, J., Zhao, K.H., Lu, W.C. | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
GRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
|
|
| PDBID: | 9ekr | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) R136W in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WDR55 in complex with XS381774 | | Authors: | Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
|
|
| PDBID: | 9el2 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el3 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktn | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of SARS-CoV-2 nsp10-nsp16 methyltransferase complex with MI54 | | Authors: | Cao, L., Xu, T.F., Yan, L.M., Yang, S.D., Zhang, H.W., Ji, Y.X., Ge, J., Fan, S.L., Li, C.M., Rao, Z.H., Lou, Z.Y., Guo, D.Y. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the pathogen-secreted apoplastic GH12 xyloglucan-specific endoglucanase XEG1 | | Authors: | Xia, Y.Q., Liu, L., Zhang, Q., Shi, X.C., Wang, Z.K., Zhang, Z.C., He, X.Y., Xiao, J.H., Jiang, H.B., Zhang, S.C., Yang, Y.H., Ye, W.W., Wang, Z.Y., Wang, Y., Ma, Z.C., Yang, Q., Wang, Y.C. | | Deposition date: | 2024-12-02 |
|
