| PDBID: | 9mnq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mns | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hup | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F194 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 7hqs | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z56912586 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqt | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104503564 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqu | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z969591530 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqv | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104477750 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqw | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z431953146 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqx | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z218760918 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqy | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z1117899682 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hqz | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z62452555 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr0 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z607808530 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr1 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57036327 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr6 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104495736 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr7 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57493539 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr8 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z104501152 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hr9 | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57984669 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hra | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z45415581 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hrb | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z106939542 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hrc | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z608061328 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hrd | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z1203162319 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hre | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z57607000 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 7hrf | | Status: | HPUB -- hold until publication | | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z33546479 | | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | | Deposition date: | 2024-12-23 |
|
