| PDBID: | 8z4c | | Status: | HOLD -- hold until a certain date | | Title: | The Fab fragment of anti-Fibrin monoclonal antibody 59D8 | | Authors: | Zhang, J., Sun, C. | | Deposition date: | 2024-04-17 | | Release date: | 2025-04-17 |
|
| PDBID: | 9bf4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structure of Paws Derived Peptide-25 (PDP-25) | | Authors: | Hajiaghaalipour, F., Wong, W., Payne, C.D., Fisher, M.F., Clark, R.J., Mylne, J.S., Rosengren, K.J. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bep | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8C, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bes | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8A, a lambda-carrageenan specific sulfatase, in complex with monosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9beu | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110B in complex with a lambda-carrageenan oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bev | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with a lambda-carrageenan oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bey | | Status: | HPUB -- hold until publication | | Title: | Structure of a lambda-carrageenan active GH2 A in complex with inhibitor | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9f0h | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal mini-shell icosahedral assembly from co-expression of CsoS1C, CsoS4A, and CsoS2-C (T = 9) | | Authors: | Wang, P., Marles-Wright, J., Liu, L.N. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9f0k | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a mammalian expression system | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bef | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beh | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8z2z | | Status: | HPUB -- hold until publication | | Title: | PRMT1-Tetramer | | Authors: | Nadendla, E.K., Wang, C.H., Ho, M.C. | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8z2q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant N253Q from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant N253T from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant R148A from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase from Deinococcus radiodurans complexed with validoxylamine A (VAA) | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 8z2u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutamt E324D from Deinococcus radiodurans complexed with validoxylamine A (VAA) | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-13 |
|
| PDBID: | 9ezf | | Status: | HOLD -- hold until a certain date | | Title: | membrane complex from Haemophilus influenzae - conformation C | | Authors: | Castro, D.S.K.V., Delepelaire, P., Biou, V. | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 8z20 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure analysis of thermotolerant Oscillatoria Phycocyanin | | Authors: | Patel, S.N., Sonani, R.R., Gupta, G.D., Upadhyaya, C.T., Sonavane, B.P., Singh, N.K., Kumar, V., Madamwar, D. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8z2l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant N253E from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bda | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9ezd | | Status: | HPUB -- hold until publication | | Title: | BsmI (Bottom Nicking mutant) crystallized with Mg2+ and cognate dsDNA (Post-reactive complex) | | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8z1h | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS main protease in complex with PF-00835231 | | Authors: | Lin, C., Zhang, J., Li, J. | | Deposition date: | 2024-04-11 | | Release date: | 2025-04-11 |
|
| PDBID: | 8z1g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human ELAC2-pre-tRNA | | Authors: | Liu, Z.M., Xue, C.Y. | | Deposition date: | 2024-04-11 |
|
