Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9fpw
Status:HPUB -- hold until publication
Title:Crystal structure of carbonic anhydrase XIII with methyl 4-(2-phenylethylsulfanyl)-3-sulfamoyl-benzoate
Authors:Smirnov, A., Manakova, E.N., Grazulis, S., Paketuryte, V.
Deposition date:2024-06-13
Sequence:

>Entity 1


MMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
PDBID:8zwf
Status:AUTH -- processed, waiting for author review and approval
Title:cryoEM structure of JR14a bound C3aR-BRIL-BAG2 complex
Authors:Luo, P., Xu, Y., Xu, H.E.
Deposition date:2024-06-13
PDBID:8zwg
Status:AUTH -- processed, waiting for author review and approval
Title:cryoEM structure of JR14a bound C3aR-Gi complex
Authors:Luo, P., Xu, Y., Xu, H.E.
Deposition date:2024-06-13
PDBID:8zx1
Status:HPUB -- hold until publication
Title:Cryo-EM structure of E.Coli membrane protein
Authors:Qiao, Z., Gao, Y.G.
Deposition date:2024-06-13
PDBID:9c91
Status:HPUB -- hold until publication
Title:Assimilatory NADPH-dependent sulfite reductase minimal dimer
Authors:Ghazi Esfahani, B., Walia, N., Neselu, K., Aragon, M., Askenasy, I., Wei, A., Mendez, J.H., Stroupe, M.E.
Deposition date:2024-06-13
PDBID:9foj
Status:AUTH -- processed, waiting for author review and approval
Title:LGTV TP21. Langat virus, strain TP21
Authors:Bisikalo, K., Rosendal, E.
Deposition date:2024-06-12
PDBID:9fp2
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of the BcsEFRQ regulatory subcomplex for E. coli cellulose secretion in non-saturating c-di-GMP (local)
Authors:Anso, I., Krasteva, P.V.
Deposition date:2024-06-12
Release date:2024-08-07
PDBID:9c8k
Status:AUTH -- processed, waiting for author review and approval
Title:Rabbit Hemorrhagic Disease Virus reinitiation stimulating TURBS RNA bound to rabbit ribosome
Authors:Sherlock, M.E., Kieft, J.S.
Deposition date:2024-06-12
PDBID:9c86
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of endogenous asymmetric DPYSL2 from rat model of Alzheimer''s disease
Authors:Khalili Samani, E., Keszei, A.F.A., Mazhab-Jafari, M.T.
Deposition date:2024-06-12
PDBID:9c8d
Status:PROC -- to be processed
Title:mouse Seipin/Adig complex
Authors:Li, C., Han, Y., Wynn, R.M., Chen, Z., Scherer, P.E.
Deposition date:2024-06-12
PDBID:9c8e
Status:PROC -- to be processed
Title:mouse Seipin complex
Authors:Li, C., Han, Y., Wynn, R.M., Chen, Z., Scherer, P.E.
Deposition date:2024-06-12
PDBID:9c8q
Status:AUTH -- processed, waiting for author review and approval
Title:Co-structure of Main Protease of SARS-CoV-2 (COVID-19) with covalent inhibitor
Authors:Knapp, M.S., Ornelas, E.
Deposition date:2024-06-12
PDBID:9c7s
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo EM structure of SARS-COV-2 (BQ 1.1) RBD in complex with Fab COV2-3891 (local refine)
Authors:Binshtein, E., Crowe, J.E.
Deposition date:2024-06-11
PDBID:9fob
Status:AUTH -- processed, waiting for author review and approval
Title:Glyceraldehyde 3-phosphate Dehydrogenase (GapA) from Helicobacter pylori in Complex with NAPD (Holo)
Authors:Elliott, P.R., Moody, P.C.E.
Deposition date:2024-06-11
PDBID:9fod
Status:AUTH -- processed, waiting for author review and approval
Title:Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) apoenzyme, from Helicobacter pylori
Authors:Foster, S.P., Moody, P.C.E.
Deposition date:2024-06-11
PDBID:8zva
Status:AUTH -- processed, waiting for author review and approval
Title:structure of ShosA from E.coli APEC O1
Authors:Yu, Y., Chen, Q., Pu, H.
Deposition date:2024-06-11
PDBID:9c7o
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of the Maize R ACT-like Domain
Authors:Silwal, J., Ghanbarpour, A., Lee, Y.S., Geiger, J.H., Grotewold, E.
Deposition date:2024-06-10
PDBID:9c7n
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of the GL3 ACT-like Domain
Authors:Ghanbarpour, A., Lee, Y.S., Silwal, J., Geiger, J.H., Grotewold, E.
Deposition date:2024-06-10
PDBID:9c6t
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the Human ISM1 TSR-AMOP domains
Authors:Stayrook, S., Li, T., Klein, D.E.
Deposition date:2024-06-08
PDBID:9c6d
Status:PROC -- to be processed
Title:Crystal structure of mutant NonPro1 Tautomerase Superfamily Member 8U6-S1P in complex with 3-bromopropiolate inhibitor
Authors:Lancaster, E.B., Hardtke, H.A., Melkonian, T.R., Venkat Ramani, M.K., Johnson Jr., W.H., Baas, B.J., Zhang, Y.J., Whitman, C.P.
Deposition date:2024-06-07
PDBID:9c66
Status:HPUB -- hold until publication
Title:Structure of the Mena EVH1 domain bound to the polyproline segment of PTP1B
Authors:LaComb, L., Fedorov, E., Bonanno, J.B., Almo, S.C., Ghosh, A.
Deposition date:2024-06-07
PDBID:9c5x
Status:AUTH -- processed, waiting for author review and approval
Title:Molecular basis for HerA-Duf supramolecular complex in anti-phage defense - Assembly 3
Authors:Rish, A.D., Fu, T.M., Fosuah, E.
Deposition date:2024-06-06
PDBID:8zt8
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of calcium preference channel P2X1
Authors:Zhang, H., Xu, H.E.
Deposition date:2024-06-06
Release date:2025-06-06
PDBID:9fm8
Status:HPUB -- hold until publication
Title:Imine Reductase from Rhodococcus erythropolis
Authors:Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G.
Deposition date:2024-06-05
PDBID:9fm7
Status:HPUB -- hold until publication
Title:Imine Reductase from Rhodococcus erythropolis
Authors:Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G.
Deposition date:2024-06-05

222415

건을2024-07-10부터공개중

PDB statisticsPDBj update infoContact PDBjnumon