| PDBID: | 8uzp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Computationally Designed Influenza Hemagglutinin Epitope Scaffold stem_mimetic_01 bound by Antibody CR9501 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8wyj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The global map of Omicron Subvariants Spike with two antibodies | | Authors: | Yan, R.H., Wang, A.J., Yang, H.N. | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8ulj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Prefusion RSV F bound by neutralizing antibody 2E08 | | Authors: | Harshbarger, W.D., Andreano, E., Malito, E. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Prefusion RSV F bound by neutralizing antibody 1G12 | | Authors: | Harshbarger, W.D., Andreano, E., Malito, E. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab of RSV neutralizing antibody 1G12 | | Authors: | Harshbarger, W.D., Andreano, E., Malito, E. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8qp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E1 glycoprotein epitope 314-324 scaffold design 1W4K_08 in complex with neutralizing antibody F(ab) fragment IGH526 | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2023-09-30 | | Sequence: | >Entity 1
MGSREVATPHRAAWLAMMLGIDASKVKGTGPGGVITVEDVKRWAEETAKATAGSENLYFQ
>Entity 2
EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKEIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
|
|
| PDBID: | 8u9y | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of neutralizing antibody HC84.26 in complex with Hepatitis C virus envelope glycoprotein E2_New interface | | Authors: | Shahid, S., Liqun, J., Liu, Y., Hasan, S.S., Mariuzza, R.A. | | Deposition date: | 2023-09-20 |
|
| PDBID: | 8tzy | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of non-neutralizing bivalent antibody CBH-4B in complex with Hepatitis C virus envelope glycoprotein E2 | | Authors: | Shahid, S., Liqun, J., Liu, Y., Hasan, S.S., Mariuzza, R.A. | | Deposition date: | 2023-08-28 |
|
| PDBID: | 8keh | | Status: | HPUB -- hold until publication | | Title: | State 2 of SARS-CoV-2 XBB Variant Spike protein trimer complexed with antibody PW5-5 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 8tn4 | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, used to study poly-N-acetyl-glucosamine broadly expressed in biofilm-forming pathogenclonal antibody | | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | | Deposition date: | 2023-08-01 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>Entity 2
EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 8tn7 | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, complexed with a disaccharide | | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | | Deposition date: | 2023-08-01 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
>Entity 2
EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
|
|
| PDBID: | 8tn5 | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, complexed with a GlcNH2 | | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | | Deposition date: | 2023-08-01 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>Entity 2
EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 8tmq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of magnesium depleted CorA in complex with conformation-specific synthetic antibody C18, State MGD-1A | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of magnesium depleted CorA in complex with conformation-specific synthetic antibody C18, State MGD-1B | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of magnesium depleted CorA in complex with conformation-specific synthetic antibody C18, State MGD-1C | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of magnesium depleted CorA in complex with conformation-specific synthetic antibody C18, State MGD-1D | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of magnesium depleted CorA in complex with conformation-specific synthetic antibody C18, State MGD-2A | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tml | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of magnesium depleted CorA in complex with conformation-specific synthetic antibody C18, State MGD-2B | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of magnesium depleted CorA in complex with conformation-specific synthetic antibody C18, State MGD-2C | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CorA in complex with conformation-specific synthetic antibody C12 and 20 mM MgCl2, State MG20-2 | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CorA in complex with conformation-specific synthetic antibody C18 and 100 uM MgCl2, State MG0.1-1A | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tme | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of CorA in complex with conformation-specific synthetic antibody C18 and 100 uM MgCl2, State MG0.1-1B | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CorA in complex with conformation-specific synthetic antibody C18 and 100 uM MgCl2, State MG0.1-1C | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CorA in complex with conformation-specific synthetic antibody C18 and 100 uM MgCl2, State MG0.1-2A | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 8tmh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CorA in complex with conformation-specific synthetic antibody C18 and 100 uM MgCl2, State MG0.1-2B | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
