| PDBID: | 9r7k | | Status: | HPUB -- hold until publication | | Title: | De novo designed enzyme for the Morita-Baylis-Hillman reaction (MBH61) | | Authors: | Tripp, A., Bijelic, A., Fischer, C., Moser, M., Oberdorfer, G. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9om5 | | Status: | HPUB -- hold until publication | | Title: | Composite map of six VRC35 Fabs and three MEDI8852 Fabs bound to influenza H3N2 Victoria 2011 hemagglutinin | | Authors: | Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Kwong, P.D., Zhou, T. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om1 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 active form 1 (class6) | | Authors: | Villagran-Suarez, A.C. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om2 | | Status: | HPUB -- hold until publication | | Title: | Full-length LRRK2 autoinhibited | | Authors: | Villagran-Suarez, A.C., Bodrug, T. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPS4BE | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9r6k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPPH | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9r5x | | Status: | HPUB -- hold until publication | | Title: | Aliphatic Amidase Variant T103I | | Authors: | Salgueiro, B.A., Karmali, A., Frazao, C. | | Deposition date: | 2025-05-10 |
|
| PDBID: | 9okm | | Status: | HPUB -- hold until publication | | Title: | Solution Structure of the Garvicin Immunity Protein | | Authors: | Mallett, T.M., Lamer, T.D., Vederas, J.C. | | Deposition date: | 2025-05-10 |
|
| PDBID: | 9okl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the Bombyx mori apo-bmCCAN | | Authors: | Yatskevich, S., Ciferri, C. | | Deposition date: | 2025-05-10 |
|
| PDBID: | 9okb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the dimeric Bombyx mori CCAN bound to DNA | | Authors: | Yatskevich, S., Ciferri, C. | | Deposition date: | 2025-05-09 |
|
| PDBID: | 9okd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the monomeric Bombyx mori CCAN bound to linear DNA | | Authors: | Yatskevich, S., Ciferri, C. | | Deposition date: | 2025-05-09 |
|
| PDBID: | 9oke | | Status: | HPUB -- hold until publication | | Title: | Structure of the Bombyx mori bmCENP-HIKM-LN-T-OP complex without the CS module | | Authors: | Yatskevich, S., Ciferri, C. | | Deposition date: | 2025-05-09 |
|
| PDBID: | 9okk | | Status: | HPUB -- hold until publication | | Title: | Bombyx mori bmCENP-LN-HIKM sub-complex structure | | Authors: | Yatskevich, S., Ciferri, C. | | Deposition date: | 2025-05-09 |
|
| PDBID: | 9uv4 | | Status: | HPUB -- hold until publication | | Title: | Structure of MHV68 glycoprotein B in complex with Fab5 | | Authors: | Cheng, B.Z., Xie, C., Sun, C., Zeng, M.S., Liu, Z., Fang, X.Y. | | Deposition date: | 2025-05-09 |
|
| PDBID: | 9uvc | | Status: | HPUB -- hold until publication | | Title: | Structure of MHV68 glycoprotein B | | Authors: | Cheng, B.Z., Fang, X.Y., Xie, C., Sun, C., Liu, Z., Zeng, M.S. | | Deposition date: | 2025-05-09 |
|
| PDBID: | 9r4y | | Status: | HPUB -- hold until publication | | Title: | 15 protofilament P. falciparum GMPCPP microtubule | | Authors: | Bangera, M., Moores, C.A. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r5d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 4,6-dibromo-5,7-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r5c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 4,7-dibromo-5,6-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r5f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 5,6-dibromo-4,7-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9uut | | Status: | PROC -- to be processed | | Title: | 4'' CF3 Modified RNA | | Authors: | Fan, C., Wang, B., Zhou, C., Plavec, J. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r48 | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: Human insulin, pH 9.0 (apo state) | | Authors: | Spiliopoulou, M., Hatton, C.E., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r4f | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: T4 Lysozyme, mutant L99A (apo state) | | Authors: | Spiliopoulou, M., Hatton, C.E., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r47 | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: Xylose isomerase bound with glucose (50 ms soaking) | | Authors: | Hatton, C.E., Spiliopoulou, M., Schulz, E.C., Mehrabi, P. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r46 | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: Xylose isomerase bound with glucose (25 ms soaking) | | Authors: | Hatton, C.E., Spiliopoulou, M., Schulz, E.C., Mehrabi, P. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r4g | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: T4 Lysozyme, mutant L99A bound with indole (1 s soaking) | | Authors: | Spiliopoulou, M., Hatton, C.E., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2025-05-07 |
|
