| PDBID: | 8s7w | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151V mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a double mutant of VirB8-like OrfG central and C-terminal domains of Streptococcus thermophilus ICESt3 (Gram positive conjugative type IV secretion system). | | Authors: | Favier, F., Didierjean, C., Maffo-Woulefack, R., Douzi, B., Leblond-Bourget, N. | | Deposition date: | 2024-03-03 |
|
| PDBID: | 8yjh | | Status: | HPUB -- hold until publication | | Title: | endogenous state A PCNA-DNA-FEN1 complex | | Authors: | Tian, Y., Gao, N. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Pseudomonas aeruginosa Recombinase A (RecA) in complex with LexAS125A mutant | | Authors: | De Felice, S., Vascon, F., Huber, S.T., Catalano, C., Jakobi, A.J., Cendron, L. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s7f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Escherichia coli LpxH in complex with EBL-2805 | | Authors: | Sooriyaarachchi, S., Mowbray, S.L., Bergfors, T., Jones, T.A. | | Deposition date: | 2024-03-01 | | Sequence: | >Entity 1
MATLFIADLHLCAEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHHQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQTLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQTAFRVVLGAWHTEGSMVKVTADDVELIHFPFHHHHHH
|
|
| PDBID: | 8yiv | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yj2 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yj3 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s76 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF67 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s77 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF234 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s75 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC FL412 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s7d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SKP1-FBXO22 in complex with a BACH1 BTB dimer at 3.2A resolution | | Authors: | Khoshouei, M., Goretzki, B. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9auq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 4-Fluoro-tryptophan labeled Oscillatoria Agardhii agglutinin | | Authors: | Runge, B.R., Zadorozhnyi, R.R., Quinn, C.M., Russell, R.W., Lu, M., Antolinez, S., Struppe, J., Schwieters, C.D., Byeon, I.L., Hadden-Perilla, J., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s70 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Pseudomonas aeruginosa recombinase A (RecA) in complex with ssDNA 72mer and ATPgS | | Authors: | De Felice, S., Vascon, F., Huber, S.T., Grinzato, A., Jakobi, A.J., Cendron, L. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s72 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of neutralizing Fab Eq4.Dp46-3D from equine antivenom bound to a consensus short chain three finger alpha-neurotoxin. | | Authors: | Ayres, F., Wibmer, C.K. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s6y | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of TEAD1 with OPN-9652 | | Authors: | Aplin, A.E. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 9au5 | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of human DNA polymerase theta polymerase domain with a cognate G:C base pair | | Authors: | Li, C., Gao, Y. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 9au8 | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of human DNA polymerase theta polymerase domain with a mismatched T:T base pair | | Authors: | Li, C., Gao, Y. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8ygv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | F1 domain of Non-catalytic site depleted and epsilon C-terminal domain deleted FoF1-ATPase from Bacillus PS3,nucleotide depleted condition | | Authors: | Kobayashi, R., Nakano, A., Mitsuoka, K., Yokoyama, K. | | Deposition date: | 2024-02-27 |
|
| PDBID: | 8yh1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Thermus thermophilus UMP kinase complexed with a phosphoryl group acceptor and donor. | | Authors: | Fukui, K., Nishiwaki, A., Nakagawa, N., Kuramitsu, S., Masui, R. | | Deposition date: | 2024-02-27 |
|
| PDBID: | 8yh8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | F1 domain of Non-catalytic site depleted and epsilon C-terminal domain deleted FoF1-ATPase from Bacillus PS3,under ATP saturated condition | | Authors: | Kobayashi, R., Nakano, A., Mitsuoka, K., Yokoyama, K. | | Deposition date: | 2024-02-27 |
|
| PDBID: | 8s6l | | Status: | HPUB -- hold until publication | | Title: | AzeD dehydratase of Pseudomonas aeruginosa | | Authors: | Calderari, A., Gruez, A., Najah, S., Li, Y., Weissman, K.J. | | Deposition date: | 2024-02-27 |
|
| PDBID: | 8s6f | | Status: | HPUB -- hold until publication | | Title: | Structure of 3C Proteinase from Coxsackievirus B3 in complex with a peptidomimetic ligand | | Authors: | Grifagni, D., Lenci, E., De Santis, A., Cantini, F., Calderone, V., Trabocchi, A., Ciofi-Baffoni, S. | | Deposition date: | 2024-02-27 | | Sequence: | >Entity 1
GPAFEFAVAMMKRNSSTVKTEYGEFTMLGIYDRWAVLPRHAKPGPTILMNDQEVGVLDAKELVDKDGTNLELTLLKLNRNEKFRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGIHVGGNGHQGFSAALLKHYFN
|
|
| PDBID: | 9atv | | Status: | HPUB -- hold until publication | | Title: | X-ray co-crystal structure of NCGC00685960 / NCATS-SM9335 in NNMT | | Authors: | Olland, A., White, A., Suto, R. | | Deposition date: | 2024-02-27 |
|
| PDBID: | 9atz | | Status: | HPUB -- hold until publication | | Title: | HIV 16055.v8.3 SOSIP Env in Complex with V2 Epitope and Anti-Immune Complex pAbs from Rabbit 2464 | | Authors: | Brown, S., Antansijevic, A., Ward, A.B. | | Deposition date: | 2024-02-27 |
|
