Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9l6j
Status:HPUB -- hold until publication
Title:Structural studies on the conformation changes induced by ligand binding in an Adenine phosphoribosyltransferase (FnAPRT) from Fusobacterium nucleatum
Authors:Kim, B., Hwang, J., Do, H., Lee, J.H.
Deposition date:2024-12-24
PDBID:9l6m
Status:HPUB -- hold until publication
Title:Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound.
Authors:Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K.
Deposition date:2024-12-24
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
PDBID:9l6n
Status:HOLD -- hold until a certain date
Title:PEDV 3CLpro mutant (C144A) in complex with nsp5/6 peptite substrate
Authors:Zhang, Y., Zhang, D., Shi, Y.J., Peng, G.Q.
Deposition date:2024-12-24
Release date:2025-12-24
PDBID:9l6p
Status:HPUB -- hold until publication
Title:Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH
Authors:Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C.
Deposition date:2024-12-24
PDBID:9l68
Status:HPUB -- hold until publication
Title:Crystal structure of human STING in complex with F8W
Authors:Feng, Z.W., Zeng, T., Chen, M.R., Xiao, Y.B., Xu, X.L.
Deposition date:2024-12-24
PDBID:9l6d
Status:HPUB -- hold until publication
Deposition date:2024-12-24
PDBID:9l69
Status:HPUB -- hold until publication
Deposition date:2024-12-24
PDBID:9huj
Status:AUTH -- processed, waiting for author review and approval
Title:CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in complex with heparin oligomer (12 subunits)
Authors:Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T.
Deposition date:2024-12-23
PDBID:9hui
Status:HPUB -- hold until publication
Title:CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in complex with heparin oligomer (20 subunits).
Authors:Bereta, G., Bielecka, E., Biela, A., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T.
Deposition date:2024-12-23
PDBID:9huh
Status:HPUB -- hold until publication
Title:CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in 10 mM calcium
Authors:Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T.
Deposition date:2024-12-23
PDBID:9hus
Status:HOLD -- hold until a certain date
Title:Structure of WT E.coli ribosome with complexed filament nascent chain at length 31, with P-site tRNAs
Authors:Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J.
Deposition date:2024-12-23
Release date:2025-12-23
PDBID:9hun
Status:HPUB -- hold until publication
Title:Crystal structure of feruloyl esterase from Fusarium oxysporum G122S variant in complex with benzoic acid
Authors:Karampa, P., Dimarogona, M., Topakas, E., Makryniotis, K., Nikolaivits, E.
Deposition date:2024-12-23
PDBID:9hux
Status:HPUB -- hold until publication
Title:CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Open Tetramer.
Authors:Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N.
Deposition date:2024-12-23
PDBID:9huq
Status:HPUB -- hold until publication
Title:Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site tRNA
Authors:Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J.
Deposition date:2024-12-23
PDBID:9huy
Status:WAIT -- processing started, waiting for author input to continue processing
Title:CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Closed1 tetramer.
Authors:Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N.
Deposition date:2024-12-23
PDBID:9huz
Status:WAIT -- processing started, waiting for author input to continue processing
Title:CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Closed2 tetramer
Authors:Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N.
Deposition date:2024-12-23
PDBID:9huk
Status:HPUB -- hold until publication
Title:Crystal structure of human GSK3b in complex with ARN24161
Authors:Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G.
Deposition date:2024-12-23
PDBID:9hv0
Status:HPUB -- hold until publication
Title:CryoEM map of the large glutamate dehydrogenase composed of 180 kDa subunits from Mycobacterium smegmatis obtained in the presence of NAD+ and L-glutamate. Empty monomer.
Authors:Lazaro, M., Chamorro, N., Lopez-Alonso, J.P., Charro, D., Rasia, R.M., Jimenez-Oses, G., Valle, M., Lisa, M.N.
Deposition date:2024-12-23
PDBID:9hul
Status:HPUB -- hold until publication
Title:Crystal structure of human GSK3b in complex with ARN25423
Authors:Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G.
Deposition date:2024-12-23
PDBID:9hut
Status:HPUB -- hold until publication
Title:Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F222
Authors:Landi, G., Pozzi, C., Mangani, S.
Deposition date:2024-12-23
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
PDBID:9huu
Status:HPUB -- hold until publication
Title:Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F223
Authors:Landi, G., Pozzi, C., Mangani, S.
Deposition date:2024-12-23
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
PDBID:9huv
Status:HPUB -- hold until publication
Title:Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F224
Authors:Landi, G., Pozzi, C., Mangani, S.
Deposition date:2024-12-23
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
PDBID:9huw
Status:HPUB -- hold until publication
Title:Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F232
Authors:Landi, G., Pozzi, C., Mangani, S.
Deposition date:2024-12-23
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
PDBID:9mno
Status:HPUB -- hold until publication
Title:Structure of the TelA-associated type VII secretion system chaperone LcpA in complex with the chaperone binding site of TelA
Authors:Garrett, S.R., Kim, Y., Whitney, J.C.
Deposition date:2024-12-23
PDBID:9mnr
Status:HOLD -- hold until a certain date
Deposition date:2024-12-23
Release date:2025-12-23

238582

건을2025-07-09부터공개중

PDB statisticsPDBj update infoContact PDBjnumon