| PDBID: | 9lpv | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpx | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpy | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at cryogenic temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpi | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 glucose complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9mzw | | Status: | HPUB -- hold until publication | | Title: | PP2A-B55 holoenzyme | | Authors: | Shi, S., Li, X., Alderman, C., Huang, W., Taylor, D., Zhao, R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzv | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3j | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of empty RHDV virion | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3h | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of RHDV mutant - N15 | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3k | | Status: | HPUB -- hold until publication | | Title: | Asymmetric cryo-EM reconstruction of the full-length E. coli transmembrane formate transporter FocA | | Authors: | Tueting, C., Janson, K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lp2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced heterodimer dAID23.4 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzc | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-22 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
>Entity 2
DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9i38 | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the de novo designed monoheme protein m4D2 with bound iron(III) 2,4-dimethyldeuteroporphyrin IX | | Authors: | Williams, C., Hutchins, G.H., Molinaro, P.M., Berrones-Reyes, J.C., Lichtenstein, B.R., Koder, R.L., Anderson, J.L.R. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3b | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 8s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3c | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3d | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3a | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 6s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3e | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of RHDV mutant - 29N | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lnt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced homotrimer mAIT03 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lns | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced homotrimer dAIT17 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lo8 | | Status: | HPUB -- hold until publication | | Title: | Twentieth polymer Msp1 from S.cerevisiae(with a catalytic dead mutation) in complex with an unknown peptide substrate | | Authors: | Chengdong, H., Simin, W., Xuan, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mxq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy] phenoxy}naphthalene-2-carbonitrile (JLJ648), a Non-nucleoside Inhibitor | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy] phenoxy}naphthalene-2-carbonitrile, a Non-nucleoside Inhibitor, with an Additional Pocket of Density | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 tetramer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy]phenoxy}naphthalene-2-carbonitrile (JLJ648), a Non-nucleoside Inhibitor | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9ln7 | | Status: | HPUB -- hold until publication | | Title: | Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state. | | Authors: | Chen, H., Sun, D., Tian, C. | | Deposition date: | 2025-01-20 |
|
