| PDBID: | 8rht | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei DHFR in complex with the cofactor and inhibitor P25 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
GSHMLSLTRILRKKIPVHELAGKISRPPLRPFSVVVASDEKGGIGDGGTIPWEIPEDMQYFRRVTTNLRGKNVKPSPSKRNAVVMGRKTWDSLPPKFRPLSNRLNVVLSRSATKEQLLAGIPDPIKRAEAANDVVAVNGGLEDALRMLVSKEHTSSIETVFCIGGGTIYKQALCAPCVNVLQAIHRTVVRPASNSCSVFFDIPAAGTKTPEGLELVRESITDERVSTGAGGKKYQFEKLVPRNS
|
|
| PDBID: | 8xh0 | | Status: | HPUB -- hold until publication | | Title: | Monoclinic crystal structure of green fluorescent protein nowGFP at pH 4.8 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2023-12-16 |
|
| PDBID: | 8xh1 | | Status: | HPUB -- hold until publication | | Title: | Orthorhombic crystal structure of green fluorescent protein nowGFP at pH 9.0 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2023-12-16 |
|
| PDBID: | 8xh2 | | Status: | HPUB -- hold until publication | | Title: | Orthorhombic crystal structure of green fluorescent protein nowGFP at pH 6.0 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2023-12-16 |
|
| PDBID: | 8rhd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8vcv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody (GPC-C epitope) | | Authors: | Brouwer, P.J.M., Perrett, H.R., Ward, A.B. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8xev | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2023-12-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8xex | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with AMP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2023-12-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8xf5 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with ADP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2023-12-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8xeh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HEPN-MNT complex | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xem | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo HEPN toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xeo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MNT antitoxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rer | | Status: | HPUB -- hold until publication | | Title: | Major groove intercalation with Polypyridyl Ruthenium complex | | Authors: | Abdullrahman, A., Cardin, C.J., Hall, J.P. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8xe8 | | Status: | HPUB -- hold until publication | | Title: | Solution structure of ubiquitin-like domain (UBL) of human ZFAND1 | | Authors: | Lai, C.H., Ko, K.T., Fan, P.J., Yu, T.A., Chang, C.F., Hsu, S.T.D. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xdj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AMPylated HEPN toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xee | | Status: | HPUB -- hold until publication | | Title: | Human DNMT3B mutant-R823G | | Authors: | Cho, C.-C., Yuan, H.S. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vb3 | | Status: | HPUB -- hold until publication | | Title: | Dienelactone hydrolase from Solimonas fluminis | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8re5 | | Status: | HPUB -- hold until publication | | Title: | Aspartyl/Asparaginyl beta-hydroxylase (AspH) R735Q variant in complex with Mn, 2-oxosuberate and a Factor X derived peptide fragment | | Authors: | Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J. | | Deposition date: | 2023-12-10 |
|
| PDBID: | 8re7 | | Status: | HPUB -- hold until publication | | Title: | Aspartyl/Asparaginyl beta-hydroxylase (AspH) R735W variant in complex with Mn, 2-oxoglutarate and a Factor X derived peptide fragment | | Authors: | Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J. | | Deposition date: | 2023-12-10 |
|
| PDBID: | 8re6 | | Status: | HPUB -- hold until publication | | Title: | Aspartyl/Asparaginyl beta-hydroxylase (AspH) R735Q variant in complex with Mn, 2-oxoglutarate and a Factor X derived peptide fragment | | Authors: | Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J. | | Deposition date: | 2023-12-10 |
|
| PDBID: | 8re9 | | Status: | HPUB -- hold until publication | | Title: | Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Mn, 2-oxoglutarate and a Factor X derived peptide fragment | | Authors: | Brasnett, A., Hou, C., Rabe, P., Brewitz, L., Schofield, C.J. | | Deposition date: | 2023-12-10 |
|
