| PDBID: | 9if6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SUMO E1 with large unit cell parameters in the P1 21 1 space group. | | Authors: | Viloria, M., Francois, R.M.M., Didierjean, C. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the peanut allergen Ara h 9 with bound Fab IGX-3103 and antiFab nanobody | | Authors: | Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-02-15 |
|
| PDBID: | 9nbm | | Status: | HPUB -- hold until publication | | Title: | Open conformation of ArsA from L. ferriphilum in complex with MgADP determined in absence of arsenite | | Authors: | Mahajan, S., Rees, D.C., Clemons, W.M. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nbo | | Status: | HPUB -- hold until publication | | Title: | Closed conformation of ArsA from L. ferriphilum in complex with MgATP and arsenite | | Authors: | Mahajan, S., Li, Y.E., Rees, D.C., Clemons, W.M. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nbr | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 with 3''deoxyribo-8oxoG:C nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nbw | | Status: | HPUB -- hold until publication | | Title: | Closed conformation of ArsA from L. ferriphilum in complex with MgATP and arsenite at 1.5 minute time point | | Authors: | Mahajan, S., Rees, D.C., Clemons, W.M. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nbl | | Status: | HPUB -- hold until publication | | Title: | Open conformation of ArsA from L. ferriphilum in complex with MgADP determined in the presence of arsenite | | Authors: | Mahajan, S., Rees, D.C., Clemons, W.M. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9ic2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of AMPK-alpha2-kinase domain bound to BAY-3827 | | Authors: | Ahangar, M.S., Zeqiraj, E., Bringas, C.F., Sakamoto, K. | | Deposition date: | 2025-02-14 | | Release date: | 2026-02-14 |
|
| PDBID: | 9icz | | Status: | HPUB -- hold until publication | | Title: | C-Methyltransferase SeMT from Saccharopolyspora erythraea | | Authors: | Weiergraeber, O.H., Haase, M., Pietruszka, J. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nb0 | | Status: | HPUB -- hold until publication | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and asymmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional expansion sequence | | Authors: | Shields, E.T., Snow, C.D. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbc | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbh | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9ibu | | Status: | HPUB -- hold until publication | | Title: | THE COLLAGEN REPEATING SEQUENCE (PRO-PRO-GLY)10 AT HIGH RESOLUTION | | Authors: | Prange, T., Girard, E., Colloc''h, N., Dhaussy, A.C. | | Deposition date: | 2025-02-13 | | Sequence: | >Entity 1
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
>Entity 2
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
|
|
| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nas | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to disordered U1A stem loop | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibb | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9lvn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase D SkPLD (Streptomyces klenkii) | | Authors: | Hu, R.K., Feng, C.H. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nab | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the alpha5beta1 integrin headpiece with OS2966 Fab | | Authors: | Wang, L., Zhang, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iax | | Status: | HPUB -- hold until publication | | Title: | DNA-PK, LX4, XLF - Catalytic domain of L4 | | Authors: | Chaplin, A.K., Hall, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iat | | Status: | HPUB -- hold until publication | | Title: | Bc8.121 Fab | | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n97 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | | Deposition date: | 2025-02-10 |
|
