| PDBID: | 9n9k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nab | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the alpha5beta1 integrin headpiece with OS2966 Fab | | Authors: | Wang, L., Zhang, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iar | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ias | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iax | | Status: | HPUB -- hold until publication | | Title: | DNA-PK, LX4, XLF - Catalytic domain of L4 | | Authors: | Chaplin, A.K., Hall, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iau | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iav | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iat | | Status: | HPUB -- hold until publication | | Title: | Bc8.121 Fab | | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ib1 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM focus map of prefusion SARS-CoV-2 spike (RBDs: 1 up & 2 down) bound to RBD-targeting MO176-117 antibody | | Authors: | Schulte, T., Wallden, W., Andrell, J., Ohlin, M. | | Deposition date: | 2025-02-11 | | Release date: | 2026-02-11 |
|
| PDBID: | 9ib6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ib7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ib8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ib9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ib2 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-11 | | Release date: | 2026-02-11 |
|
| PDBID: | 9ib3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-11 | | Release date: | 2026-02-11 |
|
| PDBID: | 9iak | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ian | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iao | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iap | | Status: | HPUB -- hold until publication | | Title: | Structure of 1 in complex with GDP-KRAS | | Authors: | Boettcher, J. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ial | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iam | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with alanylated RNA microhelices analogues mimicking Ala-tRNA-Ala substrate | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P., Legrand, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iaw | | Status: | HPUB -- hold until publication | | Title: | Structure of 5 in complex with GDP-KRAS | | Authors: | Boettcher, J. | | Deposition date: | 2025-02-11 |
|
