PDBID: | 8rs2 | Status: | HPUB -- hold until publication | Title: | Thaumatin measured via serial crystallography from a silicon HARE-chip. | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sihyun, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs3 | Status: | HPUB -- hold until publication | Title: | Thaumatin measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rsd | Status: | AUTH -- processed, waiting for author review and approval | Title: | Thaumatin measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rse | Status: | HPUB -- hold until publication | Title: | Proteinase K measured via serial crystallography from a silicon HARE-chip | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rsf | Status: | HPUB -- hold until publication | Title: | Proteinase K measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8y1i | Status: | HOLD -- hold until a certain date | Title: | Structure of guanosine-2''''-fluorinated [d(AACCGGTT)]2 | Authors: | Gao, R.Q., Cao, C., Tang, G.L. | Deposition date: | 2024-01-24 | Release date: | 2025-01-24 |
|
PDBID: | 8rro | Status: | HPUB -- hold until publication | Title: | G12V-TCR complex with HLA-A3 | Authors: | Sim, M.J.W., Sun, P.D. | Deposition date: | 2024-01-23 |
|
PDBID: | 8vrp | Status: | HPUB -- hold until publication | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | Authors: | Goldstone, D.C., Walsham, L. | Deposition date: | 2024-01-22 | Sequence: | >Entity 1 PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
PDBID: | 8xzc | Status: | HPUB -- hold until publication | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (PM20D2) Tyr314Phe mutant | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | Deposition date: | 2024-01-21 |
|
PDBID: | 8rqw | Status: | HPUB -- hold until publication | Title: | Erk2 MAP kinase (T188E) AMP-PNP complex | Authors: | Livnah, O., Gutman, D. | Deposition date: | 2024-01-20 |
|
PDBID: | 8rqx | Status: | HPUB -- hold until publication | Title: | Erk2 MAP kinase R65S+T188D - AMP-PNP complex | Authors: | livnah, O., Gutman, D. | Deposition date: | 2024-01-20 |
|
PDBID: | 8rqv | Status: | HPUB -- hold until publication | Title: | Erk2 MAP kinase (T188A) AMP-PNP complex | Authors: | Livnah, O., Gutman, D. | Deposition date: | 2024-01-19 |
|
PDBID: | 8vqu | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Dehaloperoxidase B in complex with substrate 1,4-cyclohexadiene | Authors: | de Seerano, V.S., Yun, D., Ghiladi, R.A. | Deposition date: | 2024-01-19 |
|
PDBID: | 8vqv | Status: | HPUB -- hold until publication | Title: | Structure of S. odontolytica ZTP riboswitch bound to m-1-pyridinyl-AICA | Authors: | Jones, C.P., Ferre D''Amare, A.R. | Deposition date: | 2024-01-19 |
|
PDBID: | 8vqs | Status: | HPUB -- hold until publication | Title: | Crystal structure of Dehaloperoxidase B in complex with substrate cyclohexene | Authors: | de Serrano, V.S., Yun, D., Ghiladi, R.A. | Deposition date: | 2024-01-19 |
|
PDBID: | 8vqt | Status: | HPUB -- hold until publication | Title: | Cryatal structure of Dehaloperoxidase B in complex with substrate 1-methyl-cyclohexene | Authors: | de Serrano, V.S., Yun, D., Ghiladi, R.A. | Deposition date: | 2024-01-19 |
|
PDBID: | 8xxs | Status: | HPUB -- hold until publication | Title: | Crystal structure of PDE4D catalytic domain complexed with L11 | Authors: | Wu, D., Huang, Y.-Y., Luo, H.-B. | Deposition date: | 2024-01-19 |
|
PDBID: | 8rqi | Status: | HOLD -- hold until a certain date | Title: | Structure of Rhizobium NopD with ubiquitin | Authors: | Reverter, D., Li, Y. | Deposition date: | 2024-01-18 | Release date: | 2025-01-18 |
|
PDBID: | 8vqf | Status: | HPUB -- hold until publication | Title: | X-ray crystal structure of natural Can f 1 in complex with human IgE 1J11 Fab | Authors: | Khatri, K., Ball, A., Richardson, C.M., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M. | Deposition date: | 2024-01-18 |
|
PDBID: | 8vqg | Status: | HPUB -- hold until publication | Title: | X-ray crystal structure of Can f 1 | Authors: | Khatri, K., Geoffrey, M.A., Pedersen, L.C., Champan, M.D., Pomes, A., Chruszcz, M. | Deposition date: | 2024-01-18 |
|
PDBID: | 8vq8 | Status: | HPUB -- hold until publication | Title: | Immune receptor complex | Authors: | Chaurasia, P., Littler, D.R., La Gruta, N., Rossjohn, J. | Deposition date: | 2024-01-17 |
|
PDBID: | 8xvq | Status: | HPUB -- hold until publication | Title: | Crystal structure of inulosucrase from Lactobacillus reuteri 121 in complex with fructose | Authors: | Ni, D., Hou, X., Cheng, M., Xu, W., Rao, Y., Mu, W. | Deposition date: | 2024-01-15 |
|
PDBID: | 8xvr | Status: | HPUB -- hold until publication | Title: | Crystal structure of inulosucrase from Lactobacillus reuteri 121 mutant R544W | Authors: | Ni, D., Hou, X., Cheng, M., Xu, W., Rao, Y., Mu, W. | Deposition date: | 2024-01-15 |
|
PDBID: | 8xvp | Status: | HPUB -- hold until publication | Title: | Crystal structure of inulosucrase from Lactobacillus reuteri 121 | Authors: | Ni, D., Hou, X., Cheng, M., Xu, W., Rao, Y., Mu, W. | Deposition date: | 2024-01-15 |
|
PDBID: | 8ro3 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of the staked Photosystem II - LHCII supercomplex from Chlorella ohadi | Authors: | Fadeeva, M., Klaiman, D., Caspy, I., Nelson, N. | Deposition date: | 2024-01-11 |
|