Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9dew
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of NDM-1 complexed with compound 2
Authors:Jacobs, L.M.C., Chen, Y.
Deposition date:2024-08-29
PDBID:9dfb
Status:AUTH -- processed, waiting for author review and approval
Title:Q108K:K40L:T51V:T53C:R58A:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V in the dark at pH 3.0
Authors:Bingham, C., Geiger, J.H.
Deposition date:2024-08-29
PDBID:9df8
Status:AUTH -- processed, waiting for author review and approval
Title:Q108K:K40L:T51V:T53C:R58A:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V and irradiated with UV light at pH 3.0
Authors:Bingham, C., Geiger, J.H.
Deposition date:2024-08-29
PDBID:9jcm
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Zea mays D-Phosphoglycerate dehydrogenase
Authors:Li, R., Wang, C.
Deposition date:2024-08-29
PDBID:9jci
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of human pannexin 3 in nanodisc with C-terminal truncated
Authors:Zhang, H., Zhang, H.W., Wang, D.
Deposition date:2024-08-29
PDBID:9ddu
Status:AUTH -- processed, waiting for author review and approval
Title:Q108K:K40L:T51V:T53C:R58Y:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V and irradiated with UV light at pH 3.0
Authors:Bingham, C., Geiger, J.H.
Deposition date:2024-08-28
PDBID:9de0
Status:PROC -- to be processed
Title:The Cryo-EM structure of a complex between GAD65 and b96.11 Fab
Authors:Reboul, C.F., Le, S.N., Williams, D.E., Buckle, A.M.
Deposition date:2024-08-28
Release date:2025-08-28
PDBID:9de2
Status:PROC -- to be processed
Title:ETO2 MYND bound to MPPL peptide from GATAD2A
Authors:Williams, D.C.
Deposition date:2024-08-28
PDBID:9de1
Status:AUTH -- processed, waiting for author review and approval
Title:Q108K:K40L:T51V:T53C:R58Y:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V in the dark at pH 6.0
Authors:Bingham, C., Geiger, J.H.
Deposition date:2024-08-28
PDBID:9ddl
Status:AUTH -- processed, waiting for author review and approval
Title:Glutathione transferase sigma class from Taenia solium
Authors:Miranda-Blancas, R., Cardona-Echavarria, M.C., Sanchez, C., Sanchez-Perez, L.C., Flores-Lopez, R., Rodriguez-Lima, O., Garcia-Gutierrez, P., Zubillaga, R., Landa, A., Rudino-Pinera, E.
Deposition date:2024-08-28
Release date:2025-08-28
PDBID:9de7
Status:PROC -- to be processed
Title:Structure of full-length HIV TAR RNA G16A/A17G
Authors:Bou-Nader, C., Zhang, J.
Deposition date:2024-08-28
PDBID:9de5
Status:PROC -- to be processed
Title:Structure of full-length HIV TAR RNA bound to HIV Tat RNA-binding domain
Authors:Bou-Nader, C., Zhang, J.
Deposition date:2024-08-28
PDBID:9de8
Status:PROC -- to be processed
Title:Structure of full-length HIV TAR RNA soaked in CaCl2
Authors:Bou-Nader, C., Zhang, J.
Deposition date:2024-08-28
PDBID:9de3
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of NDM-1 complexed with compound 28
Authors:Jacobs, L.M.C., Chen, Y.
Deposition date:2024-08-28
PDBID:9jc3
Status:AUTH -- processed, waiting for author review and approval
Title:The cryo-EM structure of Ac-G51DA53T P1 a-syn fibril.
Authors:Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D.
Deposition date:2024-08-28
PDBID:9jc4
Status:AUTH -- processed, waiting for author review and approval
Title:The cryo-EM structure of Ac-G51DA53T P2 a-syn fibril.
Authors:Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D.
Deposition date:2024-08-28
PDBID:9jc5
Status:AUTH -- processed, waiting for author review and approval
Title:The cryo-EM structure of Ac-G51DA53T P3 a-syn fibril.
Authors:Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D.
Deposition date:2024-08-28
PDBID:9dcr
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the TelA-associated type VII secretion system chaperone SIR_0168
Authors:Gkragkopoulou, P., Kim, Y., Whitney, J.C.
Deposition date:2024-08-27
PDBID:9glb
Status:HPUB -- hold until publication
Title:Crystal Structure of Deacetylase (HdaH) from Klebsiella pneumoniae subsp. ozaenae
Authors:Qin, C., Graf, L.G., Schulze, S., Palm, G.J., Lammers, M.
Deposition date:2024-08-27
PDBID:9glf
Status:HOLD -- hold until a certain date
Title:Anthraquinone Pigment Production Regulated by Cinnamic Acid
Authors:Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B.
Deposition date:2024-08-27
Release date:2025-08-27
Sequence:

>Entity 1


GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
PDBID:9gl5
Status:AUTH -- processed, waiting for author review and approval
Title:X-ray structure of the Thermus thermophilus Q190E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state
Authors:Neissner, K., Woehnert, J.
Deposition date:2024-08-27
PDBID:9glg
Status:AUTH -- processed, waiting for author review and approval
Title:X-ray structure of the Thermus thermophilus Q218E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state
Authors:Neissner, K., Woehnert, J.
Deposition date:2024-08-27
PDBID:9gle
Status:AUTH -- processed, waiting for author review and approval
Title:Jumonji domain-containing protein 2A with crystallization epitope mutations A91T:T93S
Authors:Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F., Structural Genomics Consortium (SGC)
Deposition date:2024-08-27
PDBID:9jbp
Status:HPUB -- hold until publication
Title:Cryo-EM structure of human SOD1 (C6A/C111A) amyloid filament
Authors:Baek, Y., Kim, H., Lee, D., Kim, D., Jo, E., Roh, S.-H., Ha, N.-C.
Deposition date:2024-08-27
PDBID:9jbo
Status:HPUB -- hold until publication
Title:Cryo-EM structure of human SOD1 (WT) amyloid filament
Authors:Baek, Y., Kim, H., Lee, D., Kim, D., Jo, E., Roh, S.-H., Ha, N.-C.
Deposition date:2024-08-27

224931

건을2024-09-11부터공개중

PDB statisticsPDBj update infoContact PDBjnumon