PDBID: | 8xr8 | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrc | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrd | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xrb | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xra | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xr9 | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2024-01-06 |
|
PDBID: | 8xhe | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhf | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhg | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhh | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xg1 | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vbh | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbc | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbd | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbe | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vb7 | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbf | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vb9 | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbg | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbi | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8rdc | Status: | HPUB -- hold until publication | Title: | Galectin-1 in complex with thiogalactoside derivative | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | Deposition date: | 2023-12-07 |
|
PDBID: | 8rci | Status: | HPUB -- hold until publication | Title: | Human p53 DNA-binding domain bound to DARPin C10 | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | Deposition date: | 2023-12-06 |
|
PDBID: | 8rc6 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of hexameric BTB domain of Drosophila CG6765 protein | Authors: | Bonchuk, A.N., Naschberger, A., Baradaran, R. | Deposition date: | 2023-12-06 | Sequence: | >Entity 1 AENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQFFATMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRGLCRT
|
|
PDBID: | 8r2p | Status: | HPUB -- hold until publication | Title: | YZwIdeal x16 a scaffold for cryo-EM of small proteins of interest crystallizing in space group 19 (P 21 21 21) | Authors: | Moche, M., Friberg, O., Nygren, P.A., Nilvebrant, J. | Deposition date: | 2023-11-07 |
|
PDBID: | 8r2n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the BeeR filament | Authors: | Bergeron, J.R.C., Kollman, J.M. | Deposition date: | 2023-11-07 |
|