| PDBID: | 9ifr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifj | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2017861827 | | Authors: | Exertier, C., Fiorillo, A., Ilari, A., Antonelli, L. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifl | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z319545618 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifz | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9lxf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9lxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 9lxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9lxj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9ncs | | Status: | HPUB -- hold until publication | | Title: | RNase A in complex with Uridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-02-17 | | Sequence: | >Entity 1
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
| PDBID: | 9nd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of WDR5 in complex with Triazole-Based Inhibitors | | Authors: | Goins, C.M., Stauffer, S.R. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncv | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of WDR5 in complex with Triazole-Based Inhibitors | | Authors: | Goins, C.M., Stauffer, S.R. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncu | | Status: | HPUB -- hold until publication | | Title: | NitrOFF1 ""OFF"" State | | Authors: | Smailys, J., Zhang, Y. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and symmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional G/C rich expansion sequence | | Authors: | Shields, E.T., Snow, C.D., Slaughter, C.K. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd7 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 75s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 for 75s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd6 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 50s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 50s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Fas-FADD complex | | Authors: | Fosuah, E., Lin, Q., Shen, Z., Fu, T.M. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncx | | Status: | HPUB -- hold until publication | | Title: | NitrOFF1 ""ON"" State | | Authors: | Smailys, J., Zhang, Y. | | Deposition date: | 2025-02-17 |
|
