| PDBID: | 8yu2 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytl | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yu7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CXCR4 tetramer | | Authors: | Liu, A., Liu, Y. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytu | | Status: | HPUB -- hold until publication | | Title: | Mipa-PETase from Micromonospora pattaloongensis | | Authors: | Hong, H., Seo, H., Park, J., Kim, K.-J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytz | | Status: | HPUB -- hold until publication | | Title: | The P185V variant of Kubu-PETase from Kutzneria buriramensis | | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yu4 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yu3 | | Status: | PROC -- to be processed | | Title: | NMR solution structure of the 2:1 complex of a platinum(II) compound bound to Myc1234 G-quadruplex | | Authors: | Liu, W., Mao, Z.W. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yty | | Status: | HPUB -- hold until publication | | Title: | The M12+P185V variant of Kubu-PETase from Kutzneria buriramensis | | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytw | | Status: | HPUB -- hold until publication | | Title: | Kubu-PETase from Kutzneria buriramensis | | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b6y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b6u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b6z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structure of the 1:1 complex of a platinum(II) compound bound to Myc1234 G-quadruplex | | Authors: | Liu, W., Mao, Z.W. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b72 | | Status: | HPUB -- hold until publication | | Title: | Rec2 Domain from G. stearothermophilus Cas9 | | Authors: | D''Ordine, A.M., Belato, H.B., Lisi, G.P., Jogl, G. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9ese | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9etp | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 1 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
| PDBID: | 9esh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
