| PDBID: | 9ndu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Ferric Human ADO C18S/C239S Variant in Complex with Hydralazine at 1.98 Angstrom Resolution | | Authors: | Liu, A., Li, J., Duan, R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifu | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 1 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9if6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SUMO E1 with large unit cell parameters in the P1 21 1 space group. | | Authors: | Viloria, M., Francois, R.M.M., Didierjean, C. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9lwc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of epinephrine bound dopamine receptor 1 D1R-M74-miniGs-Gbeta1gamma2-Nb35 complex | | Authors: | Zhang, X., Gao, K., Liu, X. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9lw0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytochrome P450PL2 from Parvibaculum lavamentivorans DS-1 | | Authors: | Cui, H.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9ib1 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM focus map of prefusion SARS-CoV-2 spike (RBDs: 1 up & 2 down) bound to RBD-targeting MO176-117 antibody | | Authors: | Schulte, T., Wallden, W., Andrell, J., Ohlin, M. | | Deposition date: | 2025-02-11 | | Release date: | 2026-02-11 |
|
| PDBID: | 9n9b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-051-22 at 1.60 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-10 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9lu8 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of yeast 1,3-beta-glucan synthase FKS2 | | Authors: | Xiang, W., Jialu, L. | | Deposition date: | 2025-02-08 | | Release date: | 2026-02-08 |
|
| PDBID: | 9n7n | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C6-AGCT DNA conjugate at 1.82 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n6f | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease M165I covalently bound to inhibitor GRL-051-22 at 1.90 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D. | | Deposition date: | 2025-02-05 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHIELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n5q | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease M49I covalently bound to inhibitor GRL-051-22 at 1.50 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-04 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDILNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n5r | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of CCoV-HuPn-2018 main protease covalently bound to inhibitor GRL-170-21 at 1.89A | | Authors: | Jayashankar, U., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-04 | | Sequence: | >Entity 1
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVSENATLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGVNLQ
|
|
| PDBID: | 9i85 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mcl-1 complex with small molecule inhibitor | | Authors: | Dokurno, P., Murray, J.B., Rubbard, R.E. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9i84 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mcl-1 complex with small molecule inhibitor | | Authors: | Dokurno, P., Murray, J.B., Rubbard, R.E. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n47 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Candida albicans pH regulated antigen 1 (Pra1) protein in the absence of Zn2+ | | Authors: | Syrjanen, J.L., Perera, R.L. | | Deposition date: | 2025-02-02 | | Release date: | 2026-02-02 |
|
| PDBID: | 9n4d | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Candida albicans pH regulated antigen 1 (Pra1) protein in complex with Zn2+ | | Authors: | Syrjanen, J.L., Perera, R.L. | | Deposition date: | 2025-02-02 | | Release date: | 2026-02-02 |
|
| PDBID: | 9lql | | Status: | HPUB -- hold until publication | | Title: | Structure of STG-hydrolyzing beta-glucosidase 1 (PSTG1) complexed with heptyl 1-thio-beta-D-glucopyranoside | | Authors: | Yanai, T., Arai, A., Takahashi, Y., Imaizumi, R., Takeshita, K., Matsuura, H., Sakai, N., Takahashi, S., Yamamoto, M., Kataoka, K., Nakayama, T., Yamashita, S. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i4k | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 | | Sequence: | >Entity 1
SMACGLVASNLNLKPGE(CME)LRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEV(CME)ITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIK(CME)VAFD
|
|
| PDBID: | 9i4l | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i4m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-1 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | | Authors: | Pachl, P. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9n0w | | Status: | HPUB -- hold until publication | | Title: | HTLV-1 Gag capsid from immature particles | | Authors: | Arndt, W.G., Ramezani, A., Chen, B., Perilla, J.R., Zhang, W., Mansky, L.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i49 | | Status: | HPUB -- hold until publication | | Title: | Cobalamin-binding chimera 10 (Cob10) (crystallization condition 1) | | Authors: | Koch, J.-S., Romero-Romero, S., Hoecker, B. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4c | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-1-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4e | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 34-1-6D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
