PDBID: | 9b9p | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 | Sequence: | >Entity 1 MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
PDBID: | 9b9y | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9z | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9bae | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9u | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with His1271Lys substitution in the coatomer binding motif, 1RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9s | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9q | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9x | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9t | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-03 |
|
PDBID: | 9b9w | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40792 | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the binary complex of DCAF1 and WDR5 | Authors: | Mabanglo, M.F., Vedadi, M., Al-awar, R. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | Authors: | Hendle, J. | Deposition date: | 2024-04-03 |
|
PDBID: | 9bab | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of Hyper2 tube, ~27 nm diameter | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | Deposition date: | 2024-04-03 | Release date: | 2025-04-03 |
|
PDBID: | 9ba6 | Status: | HPUB -- hold until publication | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the apo form | Authors: | Lee, M., Smith, A.T. | Deposition date: | 2024-04-03 |
|
PDBID: | 9bac | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of Hyper2 tube, ~24 nm diameter | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | Deposition date: | 2024-04-03 | Release date: | 2025-04-03 |
|
PDBID: | 9ba7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Vibrio cholerae N150T NFeoB variant with a single GDP molecule bound | Authors: | Lee, M., Smith, A.T. | Deposition date: | 2024-04-03 |
|
PDBID: | 9ba9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | Authors: | Hendle, J. | Deposition date: | 2024-04-03 |
|
PDBID: | 9baa | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-03 |
|
PDBID: | 9evu | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-02 |
|
PDBID: | 9evv | Status: | AUTH -- processed, waiting for author review and approval | Title: | His579Leu variant of L-arabinonate dehydratase co-crystallized with 2-oxobutyrate | Authors: | Ren, Y., Rouvinen, J., Hakulinen, N. | Deposition date: | 2024-04-02 | Release date: | 2025-04-02 |
|
PDBID: | 9evs | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of the flowering plant mitoribosome with P-site tRNA | Authors: | Waltz, F., Skaltsogiannis, V. | Deposition date: | 2024-04-02 |
|
PDBID: | 9evt | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of the small subunit of the flowering plant mitoribosome with the maturation factor RsgA | Authors: | Waltz, F., Skaltsogiannis, V. | Deposition date: | 2024-04-02 |
|
PDBID: | 9evw | Status: | HPUB -- hold until publication | Title: | Avian reovirus nonstructural protein sigmaNS | Authors: | Kascakova, B., Tuma, R. | Deposition date: | 2024-04-02 |
|