| PDBID: | 9f3q | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 1 (strain Mahoney) stabilised virus-like particle (PV1 SC6b) in complex with GPP3 and GSH. | | Authors: | Bahar, M.W., Nasta, V., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zax | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a short-chain dehydrogenase from Lactobacillus fermentum with NADPH | | Authors: | Wang, J.J., Cong, L., Wei, H.L., Liu, W.D., You, S. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8zaz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Chitinase 3-like protein 1 | | Authors: | Zhao, H.L., Huang, M.D., Jiang, L.G. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bj8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | human CRL2-ZYG11B complex | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bj9 | | Status: | HOLD -- hold until a certain date | | Title: | Human CRL-2 ZYG11B binding to human NLRP1 Gly/N degron | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bip | | Status: | HPUB -- hold until publication | | Title: | Human proton sensing receptor GPR4 in complex with miniGs | | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | | Deposition date: | 2024-04-24 |
|
| PDBID: | 9bio | | Status: | HPUB -- hold until publication | | Title: | Structure of VRC44.01 Fab in complex with 3BNC117-purified C1080.c3 RnS SOSIP.664 HIV-1 Env trimer | | Authors: | Gorman, J., Kwong, P.D. | | Deposition date: | 2024-04-23 |
|
| PDBID: | 9bie | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | human ZYG11B ElonginB/C complex binding to SARS-CoV2 Orf10 protein | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-23 |
|
| PDBID: | 9bhx | | Status: | HPUB -- hold until publication | | Title: | Structure of the extracellular domain of Protein Sevenless | | Authors: | Zhang, J., Klein, D.E. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 9bi6 | | Status: | HPUB -- hold until publication | | Title: | Human proton sensing receptor GPR68 in complex with miniGsq | | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 9f22 | | Status: | HPUB -- hold until publication | | Title: | DARPin eGFP complex DP1 (3G190.24) | | Authors: | Mittl, P.R., Winkelvoss, D. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 9f24 | | Status: | HPUB -- hold until publication | | Title: | DARPin eGFP complex DP4 (2G71) | | Authors: | Mittl, P.R., Winkelvoss, D. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 9bhl | | Status: | HPUB -- hold until publication | | Title: | Human proton sensing receptor GPR65 in complex with miniGs | | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 9bhm | | Status: | HPUB -- hold until publication | | Title: | Human proton sensing receptor GPR68 in complex with miniGs | | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 8z73 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of AF9 in complex with H3K9la peptide | | Authors: | Li, H.T., Ma, H.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z6p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z78 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea with glycerol | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgy | | Status: | HPUB -- hold until publication | | Title: | Ancestral uncoupled aspartate transporter, apo conditions, low-affinity state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgz | | Status: | HPUB -- hold until publication | | Title: | Ancestral uncoupled aspartate transporter, apo conditions, high-affinity state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bh0 | | Status: | HPUB -- hold until publication | | Title: | Ancestral uncoupled aspartate transporter in complex with L-aspartate | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bh2 | | Status: | HPUB -- hold until publication | | Title: | Apo GltPh, outward-facing state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 | | Sequence: | >Entity 1
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLVPR
|
|
| PDBID: | 9bh1 | | Status: | HPUB -- hold until publication | | Title: | Apo GltPh, intermediate outward-facing state | | Authors: | Reddy, K.D., Boudker, O. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h60 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.875 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-[[ethoxycarbonyl(methyl)amino]methyl]-5-fluoro-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid - ZN CRYSTAL FORM | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h61 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.76 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH N-[2-[6-ethyl-2-[(2-hydroxy-5-oxo-3-phenylcyclopenten-1-yl)-phenylmethyl]-1H-indol-3-yl]ethyl]acetamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
