| PDBID: | 9f8a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human monoacylglycerol lipase in complex with compound 7a | | Authors: | Kuhn, B., Ritter, M., Hornsperger, B., Bell, C., Kocer, B., Rombach, D., Richter, H., Grether, U., Gobbi, L., Kuratli, M., Collin, L., Benz, J. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f80 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Rv2242 regulator C-terminal fragment (161-414) | | Authors: | Megalizzi, V., Tanina, A., Grosse, C., Mirgaux, M., Legrand, P., Dias Mirandela, G., Wohlkonig, A., Bifani, P., Wintjens, R. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f8b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human monoacylglycerol lipase in complex with compound 7n | | Authors: | Kuhn, B., Ritter, M., Hornsperger, B., Bell, C., Kocer, B., Rombach, D., Richter, H., Grether, U., Gobbi, L., Kuratli, M., Collin, L., Benz, J. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f8c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human monoacylglycerol lipase in complex with compound 7m | | Authors: | Kuhn, B., Ritter, M., Hornsperger, B., Bell, C., Kocer, B., Rombach, D., Richter, H., Grether, U., Gobbi, L., Kuratli, M., Collin, L., Benz, J. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f8d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human monoacylglycerol lipase in complex with compound 7i | | Authors: | Kuhn, B., Ritter, M., Hornsperger, B., Bell, C., Kocer, B., Rombach, D., Richter, H., Grether, U., Gobbi, L., Kuratli, M., Collin, L., Benz, J. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 8zen | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Adr-2-Adbp-1-dsRBD0 complex | | Authors: | Liu, Z.M., Mu, J.Q., Wu, C. | | Deposition date: | 2024-05-06 | | Release date: | 2025-05-06 |
|
| PDBID: | 8zem | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of NLRP3 NACHT domain in complex with NP3-1 | | Authors: | Shi, C., Liu, Z.M. | | Deposition date: | 2024-05-06 | | Release date: | 2025-05-06 |
|
| PDBID: | 8zeo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Adr-2-Adbp-1-dsRBD1 complex | | Authors: | Liu, Z.M., Mu, J.Q., Wu, C. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 8zep | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Adr-2-Adbp-1-dsRBD2 complex | | Authors: | Liu, Z.M., Mu, J.Q., Wu, C. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9bp2 | | Status: | HPUB -- hold until publication | | Title: | The death domain (DD) of the human mucosa associated lymphoid tissue lymphoma translocation protein 1 (MALT1) | | Authors: | Chen, C.-L., Tesmer, J.J.G. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f7v | | Status: | HPUB -- hold until publication | | Title: | N-acetylglucosamine 6-phosphate dehydratase: GlcNAc6P substrate-bound state of NagS | | Authors: | Abrahams, J.P., Li, C. | | Deposition date: | 2024-05-05 |
|
| PDBID: | 8zea | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-packed tail tube (GP13) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f79 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the S. cerevisiae eIF2beta N-terminal tail bound to the C-terminal domain of eIF5 | | Authors: | Kuhle, B., Marintchev, A., Ficner, R. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 8zdh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-packed capsid (GP8 and GP113) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released capsid (GP8) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released vertex (GP8) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released tail tube (GP13) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacteriophage Douge baseplate (GP13, GP17, GP23, GP16, GP18, and GP20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge Central fiber (GP20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacteriophage Douge complete baseplate (GP13, GP17, GP23, GP16, GP18, and GP20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released connector (GP5, GP9, GP10, GP12 and GP13) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 9bnb | | Status: | HPUB -- hold until publication | | Title: | Collagen XVIII trimerization domain with introduced inter-chain disulfide bond, G(-1)C-L5C | | Authors: | Young, T., Williams, J.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zd2 | | Status: | HPUB -- hold until publication | | Title: | NMR structure of the (CGG-dsDNA:ND=) 1:2 complex | | Authors: | Sakurabayashi, S., Furuita, K., Yamada, T., Nomura, M., Nakatani, K., Kojima, C. | | Deposition date: | 2024-05-01 | | Sequence: | >Entity 1
(DC)(DT)(DA)(DA)(DC)(DG)(DG)(DA)(DA)(DT)(DG)
>Entity 2
(DC)(DA)(DT)(DT)(DC)(DG)(DG)(DT)(DT)(DA)(DG)
|
|
| PDBID: | 9f5v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
