PDBID: | 9o3r | Status: | HPUB -- hold until publication | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | Deposition date: | 2025-04-07 | Sequence: | >Entity 1 PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
PDBID: | 9o2x | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (S)-betahydroxyBocK charged NH-tRNAPyl | Authors: | Majumdar, C., Kent, A., Hamlish, N., Zhu, C., Cate, J. | Deposition date: | 2025-04-04 |
|
PDBID: | 9o2w | Status: | HPUB -- hold until publication | Title: | Crystal structure of NDM-1 complexed with compound 2b | Authors: | Jacobs, L.M.C., Chen, Y. | Deposition date: | 2025-04-04 |
|
PDBID: | 9o2v | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM Structure of VgrG4 from Hypervirulent Klebsiella pneumoniae kp52.145 | Authors: | Noske, G.D., Dominguez-Antty, J.H., Paula, T.G., Aleixo, M.A.A., Portugal, R.V., Cunha, M.M.L., Amorim, G.C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9o2y | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (R) beta-2-hydroxy-BocLysine acid charged NH-tRNAPyl | Authors: | Majumdar, C., Cate, J.H.D. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qs4 | Status: | HPUB -- hold until publication | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qro | Status: | HPUB -- hold until publication | Title: | HINT1 complexed with GS-441524-MP | Authors: | Zimberger, C., Ferron, F. | Deposition date: | 2025-04-04 | Sequence: | >Entity 1 MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
PDBID: | 9qrq | Status: | HPUB -- hold until publication | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | Authors: | Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qrr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9qsa | Status: | HPUB -- hold until publication | Title: | Mouse Ribosome rotated-1 PRE state | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | Deposition date: | 2025-04-04 |
|
PDBID: | 9ubs | Status: | HPUB -- hold until publication | Title: | The structure of the AglA_T220R-Arg complex | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-03 |
|
PDBID: | 9ubt | Status: | HPUB -- hold until publication | Title: | The structure of the AglA-Ampn-Arg complex | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-03 |
|
PDBID: | 9o18 | Status: | HPUB -- hold until publication | Title: | Fab1504 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | Authors: | Moskovitz, R., Wilson, I.A. | Deposition date: | 2025-04-03 |
|
PDBID: | 9qr4 | Status: | HPUB -- hold until publication | Title: | InlB392_T336Y: T336Y variant of Listeria monocytogenes InlB (internalin B) residues 36-392 | Authors: | Geerds, C., Niemann, H.H. | Deposition date: | 2025-04-03 |
|
PDBID: | 9ub3 | Status: | HPUB -- hold until publication | Title: | The structure of the apo-AglA from Streptomyces monomycini | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-02 |
|
PDBID: | 9ub5 | Status: | HPUB -- hold until publication | Title: | The structure of the AglA-Arg complex | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-02 |
|
PDBID: | 9uba | Status: | AUTH -- processed, waiting for author review and approval | Title: | The structure of the AglA_K196R-Arg complex | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-02 |
|
PDBID: | 9ubb | Status: | HPUB -- hold until publication | Title: | The structure of the AglA_K225E-Arg complex | Authors: | Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W. | Deposition date: | 2025-04-02 |
|
PDBID: | 9ub2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human DHODH in complex with inhibitor 006 | Authors: | Jun, L., Zhaomin, X., Caiyue, C., Yuanyuan, Z., Jin, H. | Deposition date: | 2025-04-02 | Release date: | 2026-04-02 |
|
PDBID: | 9ub9 | Status: | HPUB -- hold until publication | Title: | Wild-type Bacillus megaterium Penicillin G Acylase | Authors: | Kaewsasan, C., Rojviriya, C., Yuvaniyama, J. | Deposition date: | 2025-04-02 |
|
PDBID: | 9qr3 | Status: | HPUB -- hold until publication | Title: | Methyl-coenzyme M reductase of an ANME-2c from a microbial enrichment | Authors: | Mueller, M.-C., Wagner, T. | Deposition date: | 2025-04-02 |
|
PDBID: | 9qqt | Status: | AUTH -- processed, waiting for author review and approval | Title: | Methyl-coenzyme M reductase of ANME-2d Candidatus Methanoperedens Vercelli Strain 1 from a bioreactor enrichment culture | Authors: | Mueller, M.-C., Wagner, T. | Deposition date: | 2025-04-02 |
|
PDBID: | 9qr1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Methyl-coenzyme M reductase of ANME-2d Candidatus Methanoperedens sp. BLZ2 from a bioreactor enrichment culture | Authors: | Mueller, M.-C., Wagner, T. | Deposition date: | 2025-04-02 |
|
PDBID: | 9uay | Status: | HPUB -- hold until publication | Title: | Crystal structure of CmnI | Authors: | Hsiao, P.Y., Chang, C.Y., Peng, C.Y. | Deposition date: | 2025-04-01 |
|
PDBID: | 9o02 | Status: | HPUB -- hold until publication | Title: | Crystal structure of AfOgg1-K122S mutant bound to 8-OG DNA duplex in an intermediate state | Authors: | Huffman, J.L., Syed, A., Tang, H.Y.H., Arvai, A.S., Mol, C.D., Tainer, J.A. | Deposition date: | 2025-04-01 |
|