| PDBID: | 9iam | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with alanylated RNA microhelices analogues mimicking Ala-tRNA-Ala substrate | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P., Legrand, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n97 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n92 | | Status: | HPUB -- hold until publication | | Title: | High-resolution analysis of the human T-cell leukemia virus capsid protein reveals insights into immature particle morphology | | Authors: | Arndt, W.G., Ramezani, A., Talledge, N., Yu, G., Yang, H., Chen, B., Zhang, W., Mansky, L.M., Perilla, J.R. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SUDV glycoprotein with modified HR1c (L579P) and HR2 stalk bound to CA45 Fab | | Authors: | Lee, Y.Z., Ward, A.B., Zhu, J. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9n7w | | Status: | HPUB -- hold until publication | | Title: | antibody 5E10 Fab | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTFKLLIYYTSRLHSGVPSRFSGGGSGTDYSLTISNLEKEDIATYFCQQGNTLPRTFGGGTRLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2
(PCA)VQLLQPGAELVRPGASVRLSCKTSGYTFTSYWINWVKQRPGQGLEWIGKIFPSDSHTNYNQKFKDKATLTVDKSSSTAYMQLISPTSEDSAVYYCTRDFDTQFYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
|
|
| PDBID: | 9i94 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 3) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9c | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 29 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CAK-CDK11 | | Authors: | Cushing, V.I., Greber, B.J., McGeoch, A.J.S., Feng, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9k | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CAK-CDK2 (determined in the presence of ADP-AlFx) | | Authors: | Cushing, V.I., Greber, B.J., McGeoch, A.J.S., Feng, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i92 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 1) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i98 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 7) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i96 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 5) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9j | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CAK-CDK2 (determined in the presence of ADP-nitrate) | | Authors: | Cushing, V.I., Greber, B.J., McGeoch, A.J.S., Feng, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i93 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 2) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania braziliensis in complex with 5-(4-hydroxy-3-methoxybenzyl)pyrimidine-2,4,6(1H,3H,5H)-trione | | Authors: | Froes, T.Q., Vaidergorn, M.M., Leite, P.I.P.L., Godoi, B.F., dos Santos, T., Emery, F.S., Nonato, M.C. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n5z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Hemagglutinin CA09 homotrimer bound to AMB38310/AMB38599 Fab | | Authors: | Fernandez-Quintero, M.L., Raghavan, S.S.R., Gharpure, A., Turner, H.L., Ward, A.B. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9i84 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mcl-1 complex with small molecule inhibitor | | Authors: | Dokurno, P., Murray, J.B., Rubbard, R.E. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9i85 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mcl-1 complex with small molecule inhibitor | | Authors: | Dokurno, P., Murray, J.B., Rubbard, R.E. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9lsn | | Status: | HOLD -- hold until a certain date | | Title: | hAGO2-MID in complex with a chemical modified uridine monophosphate | | Authors: | Yao, Y.Q., Ma, J.B. | | Deposition date: | 2025-02-04 | | Release date: | 2026-02-04 |
|
| PDBID: | 9lso | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | hAGO2-MID in complex with a chemical modified uridine monophosphate | | Authors: | Yao, Y.Q., Ma, J.B. | | Deposition date: | 2025-02-04 | | Release date: | 2026-02-04 |
|
| PDBID: | 9lss | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of PDE5 with 1934 | | Authors: | Wu, D., Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n4e | | Status: | HPUB -- hold until publication | | Title: | Structure of AG2-G02 Fab in complex with influenza H3N8 A/Mallard/Alberta/362/2017 Hemagglutinin | | Authors: | Gopal, A.B., Wu, N.C., Lv, H., Pholcharee, T. | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9n4f | | Status: | HPUB -- hold until publication | | Title: | Structure of 240-14-IgA_2F02 Fab in complex with influenza H3N8 A/Mallard/Alberta/362/2017 Hemagglutinin | | Authors: | Gopal, A.B., Wu, N.C., Lv, H., Pholcharee, T. | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9lrs | | Status: | HOLD -- hold until a certain date | | Title: | The structure of MRGPRX4 with PSB-18061 | | Authors: | Cao, C., Roth, B.L. | | Deposition date: | 2025-02-01 | | Release date: | 2026-02-01 |
|
| PDBID: | 9lro | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of PDE4D with T3700 | | Authors: | Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2025-02-01 |
|
