| PDBID: | 8zg5 | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_Y505I&D303A from Streptomyces showdoensis (Apo) | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgv | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248A&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zgw | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8zg1 | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis (Apo) | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-08 |
|
| PDBID: | 9f8w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the apo Pex5 peroxisomal cargo receptor from Trypanosoma brucei | | Authors: | Banasik, M.K., Dubin, G. | | Deposition date: | 2024-05-07 |
|
| PDBID: | 7h63 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.65 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 4-[(5-fluoro-3-propan-2-yl-1H-indol-2-yl)-phenylmethyl]-3-hydroxy-2-propan-2-yl-1,2-dihydropyrrol-5-one (VINYLOGOUS ACID) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h65 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.8 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH N-[1-[2-[[2-hydroxy-3-methyl-3-(4-methylphenyl)-4-oxocyclobuten-1-yl]-phenylmethyl]-6-methyl-1H-indol-3-yl]-2-methylpropan-2-yl]acetamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bge | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of mAb8-24 bound to 426c.WITO.TM.SOSIP | | Authors: | Hurlburt, N.K., Pancera, M. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9f0k | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a mammalian expression system | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9f02 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 envelope glycoprotein (BG505 gp140 SOSIP.664) trimer in complex with three copies of ELC07 broadly neutralizing antibody. | | Authors: | Hope, J., Alguel, Y., Nans, A., Cherepanov, P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9ez0 | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a yeast expression system. | | Authors: | Bahar, M.W., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8yye | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipase CTL (Caldibacillus Thermoamylovorans) | | Authors: | Pan, S.Y., Lan, D.M., Wang, Y.H. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b7y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of TetR regulator Mce3R from Mycobacterium tuberculosis bound to a DNA oligonucleotide | | Authors: | Panagoda, N., Sampson, N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9b44 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mAb 8-24 Fab, a VRC01-like HIV-1 antibody | | Authors: | Kher, G., Hurlburt, N., Pancera, M. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8ypc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in phosphorylated state | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9ep2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-03-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9b2q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Pantothenate Synthetase from Candida albicans. | | Authors: | Regan, J., Avad, K.A., Alaidi, O., Seetharaman, J., Palmer, G.E., Hevener, K.E. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b17 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human Tryptophan 2,3-dioxygenase in complex with PAN1 inhibitor | | Authors: | Geeraerts, Z., Yeh, S.-R. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9axo | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of Antibody HY11-7E1_Ch2 Fab in Complex with Fentanyl | | Authors: | Rodarte, J.V., Pancera, M. | | Deposition date: | 2024-03-06 |
|
| PDBID: | 9axn | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of Anti-Fentanyl Antibody HY11-6B2_Mu Fab in Complex with Fentanyl | | Authors: | Rodarte, J.V., Pancera, M. | | Deposition date: | 2024-03-06 |
|
| PDBID: | 9axr | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of HY18-5B1_Ch Fab in Complex with Fentanyl | | Authors: | McGovern, M.R., Rodarte, J.V., Pancera, M. | | Deposition date: | 2024-03-06 |
|
| PDBID: | 9at2 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human Tryptophan 2,3-dioxygenase in complex with PAN3 inhibitor | | Authors: | Geeraerts, Z., Yeh, S.-R. | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8w2k | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human Tryptophan 2,3-dioxygenase in complex with PAN3F inhibitor | | Authors: | Geeraerts, Z., Yeh, S.-R. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8yc2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 capsid asymmetric unit | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8yc5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 cement-on-penton | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
