| PDBID: | 7iga | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo15 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 9vbc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural investigations of the non-heme iron-dependent oxygenase OzmD | | Authors: | Hou, X.L., Zhou, J.H. | | Deposition date: | 2025-06-04 |
|
| PDBID: | 9vbe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural investigations of the non-heme iron-dependent oxygenase OzmD | | Authors: | Hou, X.L., Zhou, J.H. | | Deposition date: | 2025-06-04 |
|
| PDBID: | 9vbf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural investigations of the non-heme iron-dependent oxygenase OzmD | | Authors: | Hou, X.L., Zhou, J.H. | | Deposition date: | 2025-06-04 |
|
| PDBID: | 9oxn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Compact, ligand-free state of Manduca sexta soluble guanylate cyclase mutant beta C122S | | Authors: | Thomas, W.C., Houghton, K.A. | | Deposition date: | 2025-06-03 |
|
| PDBID: | 9owa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human WRN helicase in complex with allosteric ligand Compound 2 | | Authors: | Palte, R.L., Koglin, M., Maskos, K., Tauchert, M.J. | | Deposition date: | 2025-06-02 |
|
| PDBID: | 9ov2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human IGA2M1 FC fragment-FC-alpha receptor (CD89) complex | | Authors: | Chandravanshi, M., Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9os3 | | Status: | PROC -- to be processed | | Title: | Human DHODH in complex with ligand H3D2856 | | Authors: | Purificacao, A.D., Nonato, M.C. | | Deposition date: | 2025-05-23 |
|
| PDBID: | 9v2x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hyaluronate lyase HylA in Streptococcus pyogenes | | Authors: | Higashi, K., Takebe, K., Sangawa, T., Tsutsumi, Y., Yamaguchi, M., Suzuki, M., Kawabata, S. | | Deposition date: | 2025-05-21 |
|
| PDBID: | 9r8t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the E3 ligase HECTD3 | | Authors: | Esposito, D., Huber, J., Maslen, S., Rittinger, K. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9olc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARg ligand-binding domain in complex with NCoR1 peptide and FTX-6746 | | Authors: | Setser, J.W., DeLaBarre, B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9olb | | Status: | HPUB -- hold until publication | | Title: | Identification of ligands for E3 ligases using fragment-based methods | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9ogw | | Status: | HPUB -- hold until publication | | Title: | Identification of ligands for E3 ligases using fragment-based methods | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2025-05-02 |
|
| PDBID: | 9ogv | | Status: | HPUB -- hold until publication | | Title: | Identification of ligands for E3 ligases using fragment-based methods | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2025-05-02 |
|
| PDBID: | 9ofr | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF THE HUMAN IGA1 FC FRAGMENT-FC-ALPHA RECEPTOR (CD89) COMPLEX | | Authors: | Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9ofs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human IGA2m2 FC fragment-FC-alpha receptor (CD89) complex | | Authors: | Chandravanshi, M., Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9oc9 | | Status: | HPUB -- hold until publication | | Title: | Human DHODH in complex with ligand H3D3181 | | Authors: | Arbelaez, M., Purificacao, A.D., Nonato, M.C. | | Deposition date: | 2025-04-23 |
|
| PDBID: | 9o8r | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of NI06063_d30_103 Fab in complex with influenza virus hemagglutinin from A/Michigan/45/2015 (H1N1) | | Authors: | Jo, G., Ward, A.B. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o8t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of NI04359_d30_240 Fab in complex with influenza virus hemagglutinin from A/Michigan/45/2015 (H1N1) | | Authors: | Jo, G., Ward, A.B. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9uik | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CCR8 in ligand free state resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma cruzi enoyl-CoA hydratase | | Authors: | Brannigan, J.A., Dodson, E.J. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
| PDBID: | 9uhu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human adenosine A2A receptor in ligand free state resolved using the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9o72 | | Status: | HPUB -- hold until publication | | Title: | Structure of turkey hemoglobin A covalently bound with epigallocatechin gallate | | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepIII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepII-HepI-PhosI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
