PDBID: | 8kck | Status: | HPUB -- hold until publication | Title: | De novo design protein -N9 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 | Sequence: | >Entity 1 GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
PDBID: | 8kc5 | Status: | HPUB -- hold until publication | Title: | De novo design protein -T09 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-06 |
|
PDBID: | 8kc4 | Status: | HPUB -- hold until publication | Title: | De novo design protein -NA05 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-06 |
|
PDBID: | 8kc8 | Status: | HPUB -- hold until publication | Title: | De novo design protein -T11 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-06 |
|
PDBID: | 8kc0 | Status: | HPUB -- hold until publication | Title: | De novo design protein -NB8 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-05 |
|
PDBID: | 8kc1 | Status: | HPUB -- hold until publication | Title: | De novo design protein -NX5 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-05 |
|
PDBID: | 8ka6 | Status: | HPUB -- hold until publication | Title: | De novo design protein -NA7 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-02 |
|
PDBID: | 8ka7 | Status: | HPUB -- hold until publication | Title: | De novo design protein -NB7 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-02 |
|
PDBID: | 8kac | Status: | HPUB -- hold until publication | Title: | De novo design protein -NX1 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-02 |
|
PDBID: | 8k8i | Status: | HPUB -- hold until publication | Title: | De novo design protein -N14 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-07-30 |
|
PDBID: | 8k8f | Status: | HPUB -- hold until publication | Title: | De novo design protein -N7 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-07-29 |
|
PDBID: | 8k8g | Status: | AUTH -- processed, waiting for author review and approval | Title: | De novo design protein -N9 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-07-29 |
|
PDBID: | 8k83 | Status: | HPUB -- hold until publication | Title: | De novo design protein -N2 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-07-28 |
|
PDBID: | 8k84 | Status: | HPUB -- hold until publication | Title: | De novo design protein -N3 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-07-28 |
|
PDBID: | 8k7o | Status: | HPUB -- hold until publication | Title: | De novo design protein -T03 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-07-27 |
|
PDBID: | 8k7z | Status: | HPUB -- hold until publication | Title: | De novo design protein -N1 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-07-27 |
|
PDBID: | 8k7m | Status: | HPUB -- hold until publication | Title: | De novo design protein -T01 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-07-26 |
|
PDBID: | 8tbc | Status: | HPUB -- hold until publication | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | Deposition date: | 2023-06-28 | Release date: | 2024-12-28 |
|
PDBID: | 7ucb | Status: | WDRN -- deposition withdrawn | Title: | X-ray Structure of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif | Authors: | Chakraborty, S., Mitra, S., Prakash, D., Prasad, P. | Deposition date: | 2022-03-16 | Release date: | 2023-09-13 |
|
PDBID: | 6wmj | Status: | WDRN -- deposition withdrawn | Title: | Structure of De Novo designed beta sheet heterodimer BHD2 | Authors: | Bera, A.K., Sahtoe, D.D., Kang, A., Sankaran, B., Baker, D. | Deposition date: | 2020-04-21 | Release date: | 2021-10-21 |
|
PDBID: | 6ed5 | Status: | WDRN -- deposition withdrawn | Title: | De Novo Three-stranded Coiled Coil Peptide Containing a Cys-rich Site in a d-position | Authors: | Ruckthong, L., Stuckey, J.A., Pecoraro, V.L. | Deposition date: | 2018-08-08 | Release date: | 2019-08-08 |
|
PDBID: | 6btu | Status: | WDRN -- deposition withdrawn | Title: | Crystal structure of the designed protein DNCR2/danoprevir/NS3a complex | Authors: | Wang, Z., Foight, G.W., Baker, D., Maly, D.J. | Deposition date: | 2017-12-07 |
|
PDBID: | 5v3l | Status: | WDRN -- deposition withdrawn | Title: | De Novo Design of Novel Covalent Constrained Meso-size Peptide Scaffolds with Unique Tertiary Structures | Authors: | Dang, B., Wu, H., Mulligan, V.K., Mravic, M., Wu, Y., Lemmin, T., Ford, A., Silva, D., Baker, D., DeGrado, W.F. | Deposition date: | 2017-03-07 |
|
PDBID: | 5v2f | Status: | WDRN -- deposition withdrawn | Title: | De Novo Design of Novel Covalent Constrained Meso-size Peptide Scaffolds with Unique Tertiary Structures | Authors: | Bobo Dang, Haifan Wu, Vikram K. Mulligan, Marco Mravic, Yibing Wu, Thomas Lemmin, Alexander Ford, Daniel Silva, David Baker, William F. DeGrado | Deposition date: | 2017-03-03 |
|
PDBID: | 5tu3 | Status: | WDRN -- deposition withdrawn | Title: | Crystal Structure of a de Novo Three-stranded Coiled Coil Peptide Containing an Ala Residue in the Second Coordination Sphere of the Hg(II)S3 binding Site | Authors: | Ruckthong, L., Stuckey, J.A., Pecoraro, V.L. | Deposition date: | 2016-11-04 |
|