| PDBID: | 9bx6 | | Status: | HPUB -- hold until publication | | Title: | Class 9 model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bx8 | | Status: | HPUB -- hold until publication | | Title: | Class 12 model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bx9 | | Status: | HPUB -- hold until publication | | Title: | Class 15 model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxb | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH DL-III-14 | | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxc | | Status: | HPUB -- hold until publication | | Title: | Consensus model for re-reduction condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxd | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH HZ-IV-188 | | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxf | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH HZ-IV-236 | | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxg | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH HZ-IV-242 | | Authors: | Tolbert, W.D., Niu, L., Pazgier, M. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxs | | Status: | HPUB -- hold until publication | | Title: | Consensus full-complex model for re-reduction condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxt | | Status: | HPUB -- hold until publication | | Title: | TrxA focus-classified model for re-reduction condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8zm0 | | Status: | HOLD -- hold until a certain date | | Title: | A self-assembled nanofiber | | Authors: | Shi, J.H., Fang, Y., Ma, D., Wang, H.M. | | Deposition date: | 2024-05-21 | | Release date: | 2025-05-21 |
|
| PDBID: | 9bwm | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bwl | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp in complex with butyryl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwo | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetyl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwp | | Status: | PROC -- to be processed | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetoacetyl-coA. | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwq | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bwr | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bvy | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bw2 | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bw3 | | Status: | HPUB -- hold until publication | | Title: | Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9fed | | Status: | HPUB -- hold until publication | | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 | | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D. | | Deposition date: | 2024-05-18 |
|
| PDBID: | 8zl7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Os ALDH2C4 (cytosolic aldehyde dehydrogenase) in complex with NADH | | Authors: | Wang, Y., Wang, W.M., Song, Z.D. | | Deposition date: | 2024-05-17 | | Release date: | 2025-05-17 |
|
| PDBID: | 9fd8 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-chloro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd9 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-nitro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd7 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
