PDBID: | 8zm0 | Status: | HOLD -- hold until a certain date | Title: | A self-assembled nanofiber | Authors: | Shi, J.H., Fang, Y., Ma, D., Wang, H.M. | Deposition date: | 2024-05-21 | Release date: | 2025-05-21 |
|
PDBID: | 8zly | Status: | HPUB -- hold until publication | Title: | Crystal structure of Streptococcus pneumoniae pyruvate kinase in complex with oxalate and fructose 1,6-bisphosphate and UDP | Authors: | Nakashima, R., Taguchi, A. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwn | Status: | HPUB -- hold until publication | Title: | Nanoparticle Crystal Structure of a Thermostabilized Mutant Rv1498A Flavoprotein from Mycobacterium tuberculosis | Authors: | Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Delany, I., Cozzi, R. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwa | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Transport and Golgi Organization protein 2 Homolog (TANGO2) | Authors: | Lovell, S., Cooper, A., Powers, A., Battaile, K.P., Mohsen, A.-W., Ghaloul-Gonzalez, L. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwm | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bwq | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bwr | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9feg | Status: | HPUB -- hold until publication | Title: | PARP15 in complex with a quinazolin-4-one inhibitor | Authors: | Bosetti, C., Lehtio, L. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvy | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-20 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bw2 | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Reduced Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-20 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bw3 | Status: | HPUB -- hold until publication | Title: | Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvz | Status: | HOLD -- hold until a certain date | Title: | SARS-CoV-2 main protease bound to inhibitor AR-A-135 | Authors: | Liu, W.R., Blankenship, L.R. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 8zlf | Status: | HPUB -- hold until publication | Title: | Crystal structure of DH domain of FYVE Domain containing protein(FP10) from Entamoeba histolytica | Authors: | Gautam, A.K., Umarao, P., Gourinath, S. | Deposition date: | 2024-05-19 |
|
PDBID: | 9bv4 | Status: | HPUB -- hold until publication | Title: | NMR Solution Structure of Excelsatoxin A in DPC micelles | Authors: | Saipriyaa, P.V., Chin, Y.K., Mehdi, M. | Deposition date: | 2024-05-19 |
|
PDBID: | 9fed | Status: | HPUB -- hold until publication | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D. | Deposition date: | 2024-05-18 |
|
PDBID: | 8zlc | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Ankyrin Repeat Protein from Plasmodium falciparum | Authors: | Kumari, P., Gautam, A.K., Gourinath, S., Malhotra, P. | Deposition date: | 2024-05-18 |
|
PDBID: | 9fdt | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdz | Status: | HPUB -- hold until publication | Title: | Single particle cryo-EM structure of the multidrug efflux pump OqxB from Klebsiella pneumoniae | Authors: | Lazarova, M., Frangakis, A., Pos, K.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdp | Status: | HPUB -- hold until publication | Title: | Single particle cryo-EM structure of the AcrB V612W monomer in the O state | Authors: | Lazarova, M., Boernsen, C., Frangakis, A., Pos, K.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdq | Status: | HPUB -- hold until publication | Title: | Single particle cryo-EM structure of the AcrB V612F monomer in the O state | Authors: | Lazarova, M., Frangakis, A., Pos, K.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdu | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with a pyridine-3-carbothioamide-based fragment inhibitor | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdw | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with a 3-chlorobenzamide-based fragment inhibitor | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdh | Status: | HPUB -- hold until publication | Title: | Closed Human phosphoglycerate kinase complex with BPG and ADP produced by cross-soaking a TSA crystal | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdn | Status: | HPUB -- hold until publication | Title: | Human phosphoglycerate kinase in complex with ATP and 3PG formed by cross-soaking a TSA crystal | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fd8 | Status: | HPUB -- hold until publication | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-chloro-cinnamaldehyde | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | Deposition date: | 2024-05-16 |
|