| PDBID: | 9iz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C37 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izl | | Status: | HPUB -- hold until publication | | Title: | hVanin-1 complexed with X17 | | Authors: | Fan, S., Zhen, L., Xie, T. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
GSTVSAEDKAAAERSKEIDKCLSREKTYVKRLVKILLLGADNSGKSTFLKQMRIIHGGSGGSGGTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVDSSDFNRLTESLNDFETIVNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENARLIFRDVKDTILHDNLKQLMLQ
>Entity 2
DVQLVESGGGLVQPGGSRKLSCSASGFAFSSFGMHWVRQAPEKGLEWVAYISSGSGTIYYADTVKGRFTISRDDPKNTLFLQMTSLRSEDTAMYYCVRSIYYYGSSPFDFWGQGTTLTVSSGGGGSGGGGSGGGGSDIVMTQATSSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLTISRLEAEDVGVYYCMQHLEYPLTFGAGTKLELK
>Entity 3
MHHHHHHHHENLYFQGSSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWNGGSGGGGSGGSSSGGVSGWRLFKKIS
>Entity 4
SNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
>Entity 5
MKTIIALSYIFCLVFADYKDDDDGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLGGSGGGGSGGSSSGGVFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVIIPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINS
|
|
| PDBID: | 9izm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy9 | | Status: | HOLD -- hold until a certain date | | Title: | Biofilm regulatory protein A from Streptococcus mutans | | Authors: | Hua, Z., Hui, W. | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9cy5 | | Status: | HPUB -- hold until publication | | Title: | Dyrk1a bound to a competitive inhibitor | | Authors: | Montfort, W.R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 FC M252H at pH 7.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cya | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C387S variant of D-ornithine/D-lysine decarboxylase complexed with HEPES and putrescine | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cxy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with AVI-1500 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cxz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with AVI-1501 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with AVI-4206 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy3 | | Status: | HPUB -- hold until publication | | Title: | Outward-facing Atorvastatin-bound OATP1B1 with sybody Sb5 | | Authors: | Sung, M.W., Lees, J.A., Han, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy4 | | Status: | HPUB -- hold until publication | | Title: | Outward-facing cyclosporine A-bound OATP1B1 with sybody 5 (Sb5) | | Authors: | Sung, M.W., Lees, J.A., Han, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy8 | | Status: | HPUB -- hold until publication | | Title: | Constrained b-hairpins targeting the EphA4 ligand binding domain | | Authors: | Muzzarelli, K.M., Assar, Z., Prentis, A.M., Baggio, C., Pellecchia, M. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
