| PDBID: | 9da1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human DNPH1 bound to inhibitor 1a | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 | | Sequence: | >Entity 1
SMRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP
|
|
| PDBID: | 9da2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DNPH1 bound to inhibitor 1b | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9d9a | | Status: | HPUB -- hold until publication | | Title: | Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: Aza-Pro substitution at position 4 | | Authors: | Wright, M.M., Rajewski, B.H., Gerrein, T.A., Smith, L.J., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9d9b | | Status: | HPUB -- hold until publication | | Title: | Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: Aza-Pro substitution at position 6 | | Authors: | Wright, M.M., Rajewski, B.H., Gerrein, T.A., Smith, L.J., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9da3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DNPH1 bound to inhibitor 2a | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9da4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DNPH1 bound to inhibitor 2b | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9da5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DNPH1 bound to inhibitor 2c | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9da6 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of human DNPH1 bound to inhibitor 3a | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9d9c | | Status: | HPUB -- hold until publication | | Title: | Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: Aza-Pro substitution at positions 4 and 6 | | Authors: | Wright, M.M., Rajewski, B.H., Gerrein, T.A., Smith, L.J., Horne, W.S., Del Valle, J.R. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9j85 | | Status: | HPUB -- hold until publication | | Title: | The complex structure of okaE with a-ketoglutarate | | Authors: | Liu, T.H., Yan, W.P. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j7w | | Status: | HPUB -- hold until publication | | Title: | Channel Rhodospin from Klebsormidium nitens (KnChR) | | Authors: | Yuzhu, Z.W., Hiroaki, A., Tatsuki, T., Fumiya, K.S., Wataru, S., Osamu, N. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d8v | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the BG505 SOSIPv2 | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9d8w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Human Enterovirus D94 A-particle | | Authors: | Fu, J., Klose, T., Rossmann, M.R., Kuhn, R., Center for Structural Genomics of Infectious Diseases (CSGID) | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9gio | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the VHL-EloC-EloB complex with a covalent compound bound to C77 of VHL. | | Authors: | Collie, G.W. | | Deposition date: | 2024-08-19 |
|
| PDBID: | 9j7h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from Providencia alcalifaciens complexed with quinic acid | | Authors: | Jangid, K., Mahto, J.K., Kumar, K.A., Kumar, P. | | Deposition date: | 2024-08-19 |
|
| PDBID: | 9d89 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | E. coli 50S ribosomal subunit in complex with PrAMP rumicidin-2 (focused refinement) | | Authors: | Pichkur, E.B., Panteleev, P.V., Konevega, A.L. | | Deposition date: | 2024-08-19 |
|
| PDBID: | 9d8b | | Status: | HPUB -- hold until publication | | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the GDP-bound form | | Authors: | Lee, M., Magante, K.D., Smith, A.T. | | Deposition date: | 2024-08-19 |
|
| PDBID: | 9d8c | | Status: | HPUB -- hold until publication | | Title: | OXA-58-NA-1-157 2.5 hour complex | | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | | Deposition date: | 2024-08-19 | | Sequence: | >Entity 1
MKLLKILSLVCLSISIGACAEHSMSRAKTSTIPQVNNSIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
|
|
| PDBID: | 9d8d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Vibrio cholerae NFeoB in the GMPPCP-bound form | | Authors: | Lee, M., Magante, K.D., Smith, A.T. | | Deposition date: | 2024-08-19 |
|
| PDBID: | 9d7y | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of scFv corresponding to human autoantibody b96.11 | | Authors: | Buckle, A.M., McGowan, S. | | Deposition date: | 2024-08-18 | | Release date: | 2025-08-18 |
|
| PDBID: | 9d7r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Fva1 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.85A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9d7t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api137 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-08-17 |
|
| PDBID: | 9ghx | | Status: | HPUB -- hold until publication | | Title: | Lysozyme covalently bound to fac-[Re(CO)3-imidazole] complex, incubated for 112 weeks. Data collection done at mammalian body temperature. | | Authors: | Jacobs, F.J.F., Brink, A., Helliwell, J.R. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9gi1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the S.aureus MecA/ClpC/ClpP degradation system | | Authors: | Azinas, S., Wallden, K., Katikaridis, P., Schahl, A., Mogk, A., Carroni, M. | | Deposition date: | 2024-08-16 |
|
