Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9w7n
Status:HPUB -- hold until publication
Title:Crystal Structure of Vaborbactam in complex with SME-1 class A Carbapenemase
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-08-06
PDBID:9w7o
Status:HPUB -- hold until publication
Title:Crystal Structure of Taniborbactam in complex with SME-1 class A Carbapenemase
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-08-06
PDBID:9w7d
Status:AUTH -- processed, waiting for author review and approval
Title:cryo-EM structure of PSII PsbA3-S264V in complex with DCMU from Thermosynechococcus vestitus BP-1
Authors:Fan, S.B., Jiang, H.W., Kato, K., Tsai, P.-C., Jia, A.Q., Nakajima, Y., Sugiura, M., Shen, J.R.
Deposition date:2025-08-06
PDBID:9w7p
Status:HPUB -- hold until publication
Title:Crystal Structure of Ledaborbactam in complex with SME-1 class A Carbapenemase
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-08-06
PDBID:9px8
Status:HPUB -- hold until publication
Title:Cryo-EM structure of designed Orb2 amyloid (LVLVF, polymorph 1)
Authors:Singh, R., Kaili, L., Si, K., Joachimiak, L.
Deposition date:2025-08-05
Sequence:

>Entity 1


QLHQQQHQQQHLQHVQHLQQVQFHQHQQQLS
PDBID:9w6s
Status:HPUB -- hold until publication
Title:hCA450-21.1 Fab and GD2 complex
Authors:Deyong, S., Muding, R.
Deposition date:2025-08-05
PDBID:9w72
Status:HPUB -- hold until publication
Title:Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1) assembled with DNA truncated at SHL-5.5
Authors:Mu, Z., Huang, J.
Deposition date:2025-08-05
PDBID:9s7m
Status:HPUB -- hold until publication
Title:HIV-1 capsid (M-group) - native in complex with JW3-093
Authors:Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A.
Deposition date:2025-08-04
PDBID:9w6j
Status:HPUB -- hold until publication
Title:Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1, top NCP) assembled with DNA truncated at SHL-5.5
Authors:Mu, Z., Huang, J.
Deposition date:2025-08-04
PDBID:9w6k
Status:HPUB -- hold until publication
Title:Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1&2, bottom NCP) assembled with DNA truncated at SHL-5.5
Authors:Mu, Z., Huang, J.
Deposition date:2025-08-04
PDBID:9w6d
Status:HPUB -- hold until publication
Title:EricAPN in complex with RU15-1 RBD
Authors:Zhu, Q.
Deposition date:2025-08-04
PDBID:9pvx
Status:HPUB -- hold until publication
Title:RNA polymerase II elongation complex with dA at +1 site, 8-oxo-GTP bound in E-site.
Authors:Hou, P., Oh, J., Wang, D.
Deposition date:2025-08-03
PDBID:9pvo
Status:HPUB -- hold until publication
Title:Novel site 1 interaction of the IR/Ins-AC-S2 complex
Authors:Vogel, A., Blakely, A., Hill, C.P.
Deposition date:2025-08-03
PDBID:9pvu
Status:HPUB -- hold until publication
Title:RNA polymerase II elongation complex with dC at +1 site, 8-oxo-GMP added.
Authors:Hou, P., Oh, J., Wang, D.
Deposition date:2025-08-03
PDBID:9pvv
Status:HPUB -- hold until publication
Title:RNA polymerase II elongation complex with dC at +1 site, 8-oxo-GTP bound in A-site.
Authors:Hou, P., Oh, J., Wang, D.
Deposition date:2025-08-03
PDBID:9pvw
Status:HPUB -- hold until publication
Title:RNA polymerase II elongation complex with dA at +1 site, 8-oxo-GMP added in Syn-conformation
Authors:Hou, P., Oh, J., Wang, D.
Deposition date:2025-08-03
PDBID:9pvn
Status:HPUB -- hold until publication
Title:Human malic enzyme 3 complex with inhibitor NPD-389 at 1.82 Angstrom.
Authors:Krinkel, B.A., Yosaatmadja, Y., Squire, C.J., Loomes, K.M.
Deposition date:2025-08-02
PDBID:9s6j
Status:HPUB -- hold until publication
Title:HIV-1 capsid (M-group) - CPSF6
Authors:Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A.
Deposition date:2025-08-01
PDBID:9s6v
Status:AUTH -- processed, waiting for author review and approval
Title:HIV-1 capsid (M-group) - native in complex with JW3-094
Authors:Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A.
Deposition date:2025-08-01
PDBID:9w5b
Status:AUTH -- processed, waiting for author review and approval
Title:cryo-EM structure of PSII D1-S264V from Thermosynechococcus vestitus BP-1
Authors:Fan, S.B., Jiang, H.W., Kato, K., Tsai, P.-C., Jia, A.Q., Nakajima, Y., Sugiura, M., Shen, J.-R.
Deposition date:2025-08-01
PDBID:9s65
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of human Programmed cell death 1 ligand 1 (PD-L1) with a covalent inhibitor
Authors:Wilk, P., Kitel, R.
Deposition date:2025-07-31
PDBID:9pur
Status:HPUB -- hold until publication
Title:Human respirovirus 1 hemagglutinin-neuraminidase dimer in complex with VHH A2R3-60
Authors:Zhou, L., McLellan, J.S.
Deposition date:2025-07-31
PDBID:9s64
Status:HPUB -- hold until publication
Title:Human TEAD1 in complex with 2-(4-chloro-3-{3-methyl-5-[4-(trifluoromethyl)phenoxy]phenyl}-1H-pyrrolo[3,2-c]pyridin-1-yl)ethan-1-ol
Authors:Musil, D., Freire, F.
Deposition date:2025-07-30
PDBID:9w43
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the complex of human PD-1 and a PD-1-directed antibody
Authors:Jiang, W.B., Xu, J.L.
Deposition date:2025-07-30
Release date:2026-07-30
PDBID:9s5q
Status:HPUB -- hold until publication
Title:Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time 1 s
Authors:Williams, L.J., Worrall, J.A.R., Hough, M.A.
Deposition date:2025-07-29
Sequence:

>Entity 1


DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA

243911

건을2025-10-29부터공개중

PDB statisticsPDBj update infoContact PDBjnumon