Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:7i8b
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 54b bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:7i8c
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 54b bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:7i8d
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 61a bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:7i8e
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 58d bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:7i8f
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 58e bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:7i8g
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 58f bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:7i8h
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 58b bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:7i8i
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 61b bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:7i8j
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 61g bound to CK2a
Authors:Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D.
Deposition date:2025-03-12
PDBID:9nph
Status:HPUB -- hold until publication
Title:X-ray crystal structure of recombinant Can f 1 in complex with human IgE mAb 1J11 Fab
Authors:Khatri, K., Ball, A., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M.
Deposition date:2025-03-11
PDBID:9npi
Status:HPUB -- hold until publication
Title:X-ray crystal structure of recombinant Can f 1 in complex with human IgE 12F3 Fab
Authors:Khatri, K., Ball, A., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M.
Deposition date:2025-03-11
PDBID:9npg
Status:HPUB -- hold until publication
Title:X-ray crystal structure of recombinant Can f 1-C100S in complex with human IgE mAb 12F3 Fab
Authors:Khatri, K., Ball, A., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M.
Deposition date:2025-03-11
PDBID:9qd6
Status:HOLD -- hold until a certain date
Title:High resolution structure of the artificially maturated [FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough
Authors:Bikbaev, K., Harand, T., Scheuenstuhl, L., Span, I.
Deposition date:2025-03-06
Release date:2025-04-03
PDBID:9qdc
Status:HOLD -- hold until a certain date
Title:Nitratidesulfovibrio vulgaris [FeFe]-hydrogenase crystallized in the sodium formate buffer at pH 4.6
Authors:Bikbaev, K., Span, I.
Deposition date:2025-03-06
Release date:2025-04-03
PDBID:9qdd
Status:HOLD -- hold until a certain date
Title:Nitratidesulfovibrio vulgaris [FeFe]-hydrogenase crystallized in the sodium acetate buffer at pH 5.3
Authors:Bikbaev, K., Span, I.
Deposition date:2025-03-06
Release date:2025-04-03
PDBID:9qdg
Status:HOLD -- hold until a certain date
Title:Nitratidesulfovibrio vulgaris [FeFe] hydrogenase crystallized in the sodium propionate buffer at pH 5.0
Authors:Bikbaev, K., Span, I.
Deposition date:2025-03-06
Release date:2026-03-06
PDBID:9qdk
Status:HPUB -- hold until publication
Title:Trypanosoma brucei PTR1 in complex with fragment L330 and compound F46
Authors:Landi, G., Mangani, S., Pozzi, C.
Deposition date:2025-03-06
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
PDBID:9m54
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Cryo-EM structure of neuropeptide FF receptor 2 complex with NPVF
Authors:Pan, B.X., Jiang, Y., Li, X.Z.
Deposition date:2025-03-05
PDBID:9m2f
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Structure of neuropeptide FF receptor 1 complex with NPFF
Authors:Pan, B.X., Jiang, Y., Li, X.Z.
Deposition date:2025-02-27
PDBID:9m2a
Status:HPUB -- hold until publication
Title:The crystal structure of the trypanosome alternative oxidase complexed with a trypanocidal phosphonium derivative (compound1)
Authors:Ebiloma, G.U., Balogun, E.O., Dardonville, C., De Koning, H.P., Shiba, T.
Deposition date:2025-02-27
PDBID:9m1o
Status:HPUB -- hold until publication
Title:Cryo-EM structures of NPFFR2 complex with neuropeptide FF
Authors:Pan, B.X., Li, X.Z., Jiang, Y.
Deposition date:2025-02-26
PDBID:9m0r
Status:HPUB -- hold until publication
Title:Structure of neuropeptide FF receptor 1 complex with NPVF
Authors:Pan, B.X., Jiang, Y., Li, X.Z.
Deposition date:2025-02-25
PDBID:9lym
Status:HPUB -- hold until publication
Title:Functional characterization of type III polyketide synthases involved in tropane alkaloid biosynthesis in Brassicaceae
Authors:Yan, Y.J., Huang, S.X.
Deposition date:2025-02-20
PDBID:9iga
Status:AUTH -- processed, waiting for author review and approval
Title:Beta-hairpin macrocyclic peptide in complex with STAT1
Authors:Pantelejevs, T.
Deposition date:2025-02-19
PDBID:9ife
Status:HPUB -- hold until publication
Title:PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z943693514
Authors:Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A.
Deposition date:2025-02-18

238582

건을2025-07-09부터공개중

PDB statisticsPDBj update infoContact PDBjnumon